Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54825
Gene name	Cadherin related family member 2
Gene symbol	CDHR2
Synonyms (NCBI Gene)	PCDH24PCLCKPCLKC
Chromosome	5
Chromosome location	5q35.2
Summary	This gene is a member of the protocadherin family, which represents a subset of the larger cadherin superfamily. The members of the protocadherin family encode non-classical cadherins that function as calcium-dependent cell-cell adhesion molecules. This p

8 Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018407	hsa-miR-335-5p	Microarray	18185580
MIRT1960741	hsa-miR-3925-3p	CLIP-seq
MIRT1960742	hsa-miR-4270	CLIP-seq
MIRT1960743	hsa-miR-4441	CLIP-seq
MIRT1960744	hsa-miR-4685-5p	CLIP-seq
MIRT1960745	hsa-miR-552	CLIP-seq
MIRT1960746	hsa-miR-764	CLIP-seq
MIRT1960747	hsa-miR-766	CLIP-seq

32 Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	12117771, 24725409
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24725409
GO:0005886	Component	Plasma membrane	IEA
GO:0005902	Component	Microvillus	IDA	32209652
GO:0005903	Component	Brush border	IDA	21330445
GO:0005912	Component	Adherens junction	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	12117771, 24725409
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	IBA
GO:0030855	Process	Epithelial cell differentiation	IDA	12117771
GO:0031526	Component	Brush border membrane	IDA	24725409
GO:0031528	Component	Microvillus membrane	IDA	12117771, 24725409
GO:0031528	Component	Microvillus membrane	IEA
GO:0032532	Process	Regulation of microvillus length	IMP	24725409
GO:0042995	Component	Cell projection	IEA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IDA	12117771
GO:0050839	Function	Cell adhesion molecule binding	IDA	24725409
GO:0060243	Process	Negative regulation of cell growth involved in contact inhibition	IDA	12117771
GO:0060429	Process	Epithelium development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0090675	Process	Intermicrovillar adhesion	IMP	24725409
GO:0098609	Process	Cell-cell adhesion	IEA
GO:1904970	Process	Brush border assembly	IDA	32209652

MIM	HGNC	e!Ensembl
619713	18231	ENSG00000074276

Q9BYE9

Protein name

Cadherin-related family member 2 (Protocadherin LKC) (PC-LKC) (Protocadherin-24)

Protein function

Intermicrovillar adhesion molecule that forms, via its extracellular domain, calcium-dependent heterophilic complexes with CDHR5 on adjacent microvilli. Thereby, controls the packing of microvilli at the apical membrane of epithelial cells. Thro

PDB

5CZR , 7N86

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	485 → 577	Cadherin domain	Domain
PF00028	Cadherin	590 → 686	Cadherin domain	Domain
PF00028	Cadherin	246 → 342	Cadherin domain	Domain
PF00028	Cadherin	700 → 799	Cadherin domain	Domain
PF00028	Cadherin	935 → 1041	Cadherin domain	Domain
PF00028	Cadherin	31 → 115	Cadherin domain	Domain
PF00028	Cadherin	129 → 225	Cadherin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, kidney and colon. Moderately expressed in small intestine. Down-regulated in a number of liver and colon cancers (PubMed:12117771, PubMed:15534908). Expressed in duodenum with higher expression in enterocytes

Sequence

MAQLWLSCFLLPALVVSVAANVAPKFLANMTSVILPEDLPVGAQAFWLVAEDQDNDPLTY
GMSGPNAYFFAVTPKTGEVKLASALDYETLYTFKVTISVSDPYIQVQREMLVIVEDRNDN
APVFQNTAFSTSINETLPVGSVVFSVLAVDKDMGSAGMVVYSIEKVIPSTGDSEHLFRIL
ANGSIVLNGSLSYNNKSAFYQLELKACDLGGMYHNTFTIQCSLPVFLSISVVDQPDLDPQ
FVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVN
GSLDREQLLEADEEVQLQVTATETHLNIYGQEAKVSIWVTVRVMDVNDHKPEFYNCSLPA
CTFTPEEAQVNFTGYVDEHASPRIPIDDLTMVVYDPDKGSNGTFLLSLGGPDAEAFSVSP
ERAVGSASVQVLVRVSALVDYERQTAMAVQVVATDSVSQNFSVAMVTIHLRDINDHRPTF
PQSLYVLTVPEHSATGSVVTDSIHATDPDTGAWGQITYSLLPGNGADLFQVDPVSGTVTV
RNGELLDRESQAVYYLTLQATDGGNLSSSTTLQIHLLDINDNAPVVSGSYNIFVQEEEGN
VSVTIQAHDNDEPGTNNSRLLFNLLPGPYSHNFSLDPDTGLLRNLGPLDREAIDPALEGR
IVLTVLVSDCGEPVLGTKVNVTITVEDINDNLPIFNQSSYNFTVKEEDPGVLVGVVKAWD
ADQTEANNRISFSLSGSGANYFMIRGLVLGAGWAEGYLRLPPDVSLDYETQPVFNLTVSA
ENPDPQGGETIVDVCVNVKDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVVASDVDTSA
QLEIQLVNILCTKAGVDVGSLCWGWFSVAANGSVYINQSKAIDYEACDLVTLVVRACDLA
TDPGFQAYSNNGSLLITIEDVNDNAPYFLPENKTFVIIPELVLPNREVASVRARDDDSGN
NGVILFSILRVDFISKDGATIPFQGVFSIFTSSEADVFAGSIQPVTSLDSTLQGTYQVTV
QARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVY
IVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGS
QESQESDLSKQLISVIIGLGVALLLVLVIMTMAFVCVRKSYNRKLQAMKAAKEARKTAAG
VMPSAPAIPGTNMYNTERANPMLNLPNKDLGLEYLSPSNDLDSVSVNSLDDNSVDVDKNS
QEIKEHRPPHTPPEPDPEPLSVVLLGRQAGASGQLEGPSYTNAGLDTTDL

Sequence length

1310

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15534908, 37774952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12117771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19383367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30296522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	30296522	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31310545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	30296522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30854092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12117771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12117771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12117771, 30854092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	40170581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	40170581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with CDHR2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CDHR2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CDHR2 (see Related Genes above), that are NOT already directly curated for CDHR2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CDHR2.

CDHR2 (cadherin related family member 2)

Save This Analysis