CDH5 (cadherin 5)

Gene

• Entrez ID: 1003
• Gene name: Cadherin 5
• Gene symbol: CDH5
• Synonyms (NCBI Gene): 7B4, CD144
• Chromosome: 16
• Chromosome location: 16q21
• Summary: This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT017265	hsa-miR-335-5p	Microarray	18185580
MIRT021947	hsa-miR-128-3p	Microarray	17612493
MIRT029178	hsa-miR-26b-5p	Microarray	19088304
MIRT052977	hsa-miR-125b-5p	qRT-PCR, Western blot	22391569
MIRT053051	hsa-miR-101-3p	Luciferase reporter assay, Western blot	23554480
MIRT710488	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT710487	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT710486	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT710485	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT710484	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT710483	hsa-miR-4512	HITS-CLIP	19536157
MIRT710482	hsa-miR-4761-5p	HITS-CLIP	19536157
MIRT710481	hsa-miR-3918	HITS-CLIP	19536157
MIRT710480	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT710479	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT710478	hsa-miR-4772-3p	HITS-CLIP	19536157
MIRT710477	hsa-miR-2276-3p	HITS-CLIP	19536157
MIRT710476	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT710475	hsa-miR-6132	HITS-CLIP	19536157
MIRT710474	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT710473	hsa-miR-4297	HITS-CLIP	19536157
MIRT710472	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT710471	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT710470	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT710469	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT710468	hsa-miR-544a	HITS-CLIP	19536157
MIRT732198	mmu-miR-27a-3p	ChIP-seq, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26980408
MIRT732198	mmu-miR-27a-3p	ChIP-seq, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26980408
MIRT734215	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33274193
MIRT710488	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT710487	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT710486	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT710485	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT710484	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT710483	hsa-miR-4512	HITS-CLIP	19536157
MIRT710482	hsa-miR-4761-5p	HITS-CLIP	19536157
MIRT710481	hsa-miR-3918	HITS-CLIP	19536157
MIRT710480	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT710479	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT710478	hsa-miR-4772-3p	HITS-CLIP	19536157
MIRT710477	hsa-miR-2276-3p	HITS-CLIP	19536157
MIRT710476	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT710475	hsa-miR-6132	HITS-CLIP	19536157
MIRT710474	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT710473	hsa-miR-4297	HITS-CLIP	19536157
MIRT710472	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT710471	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT710470	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT710469	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT710468	hsa-miR-544a	HITS-CLIP	19536157
MIRT756298	hsa-miR-125a-5p	Luciferase reporter assay, Immunofluorescence	35401562
MIRT879864	hsa-miR-2355-5p	CLIP-seq
MIRT879865	hsa-miR-759	CLIP-seq
MIRT1556161	hsa-miR-1294	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT1556163	hsa-miR-4436a	CLIP-seq
MIRT1556164	hsa-miR-711	CLIP-seq
MIRT1960720	hsa-miR-1273g	CLIP-seq
MIRT1960721	hsa-miR-2110	CLIP-seq
MIRT1960722	hsa-miR-3150a-3p	CLIP-seq
MIRT1960723	hsa-miR-3151	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT1960724	hsa-miR-486-3p	CLIP-seq
MIRT1960725	hsa-miR-541	CLIP-seq
MIRT1960726	hsa-miR-654-5p	CLIP-seq
MIRT1960727	hsa-miR-939	CLIP-seq
MIRT2197357	hsa-miR-103a	CLIP-seq
MIRT2197358	hsa-miR-107	CLIP-seq
MIRT2197359	hsa-miR-1184	CLIP-seq
MIRT2197360	hsa-miR-1205	CLIP-seq
MIRT2197361	hsa-miR-1587	CLIP-seq
MIRT2197362	hsa-miR-1909	CLIP-seq
MIRT879864	hsa-miR-2355-5p	CLIP-seq
MIRT1960722	hsa-miR-3150a-3p	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT2197363	hsa-miR-3179	CLIP-seq
MIRT2197364	hsa-miR-378g	CLIP-seq
MIRT2197365	hsa-miR-4492	CLIP-seq
MIRT2197366	hsa-miR-4498	CLIP-seq
MIRT2197367	hsa-miR-4505	CLIP-seq
MIRT2197368	hsa-miR-4656	CLIP-seq
MIRT2197369	hsa-miR-4667-5p	CLIP-seq
MIRT2197370	hsa-miR-4675	CLIP-seq
MIRT2197371	hsa-miR-4700-5p	CLIP-seq
MIRT2197372	hsa-miR-4731-5p	CLIP-seq
MIRT2197373	hsa-miR-4741	CLIP-seq
MIRT2197374	hsa-miR-622	CLIP-seq
MIRT2197375	hsa-miR-661	CLIP-seq
MIRT2197376	hsa-miR-762	CLIP-seq
MIRT1960727	hsa-miR-939	CLIP-seq
MIRT1556164	hsa-miR-711	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ERG	Unknown	19359602
KLF4	Activation	20724706

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0001886	Process	Endothelial cell morphogenesis	IEA
GO:0001886	Process	Endothelial cell morphogenesis	ISS
GO:0001955	Process	Blood vessel maturation	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	ISS
GO:0005102	Function	Signaling receptor binding	IPI	12088286
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15985432, 17057644, 18287330, 18662404, 20010843, 20123964, 20332120, 21183689, 26923917, 28514442, 33961781, 39232006
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IDA	25978380
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9219219
GO:0005911	Component	Cell-cell junction	IDA	15572031, 19996314, 20332120, 21168935, 23288152
GO:0005911	Component	Cell-cell junction	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IDA	25978380, 26598555, 27338829
GO:0005912	Component	Adherens junction	IEA
GO:0005912	Component	Adherens junction	IMP	26923917
GO:0005912	Component	Adherens junction	ISS
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	23159740
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007043	Process	Cell-cell junction assembly	IMP	23288152
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	TAS	9219219
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	23159740
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	21168935
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008013	Function	Beta-catenin binding	IPI	18287330
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	23288152
GO:0010628	Process	Positive regulation of gene expression	IMP	26598555
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9219219
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0019903	Function	Protein phosphatase binding	IBA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	28926625
GO:0030054	Component	Cell junction	IEA
GO:0030054	Component	Cell junction	ISS
GO:0030159	Function	Signaling receptor complex adaptor activity	IMP	11950700
GO:0030335	Process	Positive regulation of cell migration	IDA	15572031
GO:0030513	Process	Positive regulation of BMP signaling pathway	IMP	26598555
GO:0031115	Process	Negative regulation of microtubule polymerization	IDA	23159740
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	26598555
GO:0031965	Component	Nuclear membrane	IDA
GO:0034332	Process	Adherens junction organization	IBA
GO:0034332	Process	Adherens junction organization	IDA	26598555
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0043114	Process	Regulation of vascular permeability	IDA	23159740, 26598555
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	25893857
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043534	Process	Blood vessel endothelial cell migration	IMP	31934175
GO:0044325	Function	Transmembrane transporter binding	IPI	19996314
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IDA	26598555
GO:0045296	Function	Cadherin binding	IBA
GO:0045766	Process	Positive regulation of angiogenesis	IGI	22391569
GO:0046872	Function	Metal ion binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IGI	28112401
GO:0070051	Function	Fibrinogen binding	IMP	19413351
GO:0070161	Component	Anchoring junction	IEA
GO:0070700	Function	BMP receptor binding	IPI	26598555
GO:0070830	Process	Bicellular tight junction assembly	IMP	25753039
GO:0071944	Component	Cell periphery	IEA
GO:0098609	Process	Cell-cell adhesion	IDA	15572031
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	ISS
GO:1902396	Process	Protein localization to bicellular tight junction	IMP	25753039
GO:1902533	Process	Positive regulation of intracellular signal transduction	IDA	23159740
GO:1903142	Process	Positive regulation of establishment of endothelial barrier	IMP	23288152
GO:1990782	Function	Protein tyrosine kinase binding	IPI	11950700
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	IMP	20332120
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	31934175

Other IDs

• MIM: 601120
• HGNC: 1764
• e!Ensembl: ENSG00000179776

Protein

• UniProt ID: P33151
• Protein name: Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)
• Protein function: Cadherins are calcium-dependent cell adhesion proteins (By similarity). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (PubMed:212
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00028	Cadherin	52 → 142	Cadherin domain	Domain
  PF00028	Cadherin	156 → 249	Cadherin domain	Domain
  PF00028	Cadherin	263 → 364	Cadherin domain	Domain
  PF00028	Cadherin	377 → 470	Cadherin domain	Domain
  PF00028	Cadherin	483 → 576	Cadherin domain	Domain
  PF01049	Cadherin_C	621 → 777	Cadherin cytoplasmic region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in endothelial cells (at protein level) (PubMed:27338829). Expressed in the brain (PubMed:2059658). {ECO:0000269|PubMed:2059658, ECO:0000269|PubMed:27338829}.
• Sequence:

  MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
  NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
  VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
  PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
  TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
  DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
  INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
  VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
  KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
  GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
  VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
  SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
  DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
  ELLY

• Sequence length: 784

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	11106238		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	15044918		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31346954		★☆☆☆☆ Found in Text Mining only
Alveolar capillary dysplasia	Alveolar capillary dysplasia	Pubtator	38029923	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	11937138	Stimulate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	38155384	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	24526692		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28424820, 30340104		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	33144896	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21905018	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28424820, 30340104		★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	Pubtator	39354406	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32807774	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	18422935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25278075	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10969774, 15810954, 19046938, 22833667, 23216791, 27010749, 29143117		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18628953, 20386594, 27693459, 33899544, 34205118	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	9434630	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	24885155	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33108070, 34358255	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	30945361	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33118329	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27362942		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20121140, 34358255, 36138026	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24589413		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29115553	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12963640		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32119531	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	14532881	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	14532881	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31346954		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18507500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29460088		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	31400307		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31005422		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18420943	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26833791, 31257478		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	40170649	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27838104		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26069241	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27838104		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27838104	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30988072		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	30988072	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	24665005		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24589413		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29486902		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37766459	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	37340071	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31188231		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23029099, 23543272, 24868550	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23645533		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23645533		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23543272	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30368528		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	30301260	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	20809761	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	37910143	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	30955248		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17883332, 28211084, 30787185		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23543272, 30945361	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27627890, 33326735	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33737411	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30747487		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34522168	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22765916		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30995547		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	36934253	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30658667		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30658667		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17638851	Associate	★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	30978483		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28498353		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	40065360	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33728331	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23089909	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34166375	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10969774, 15810954, 19046938, 22833667, 23216791, 27010749, 29143117		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27362942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28599281		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27466381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	9605742		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27466381, 29187459, 29310118, 29949786		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18316602, 18628953		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18507500		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29371244		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31346954		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11416160, 16481735, 20181932, 25447529, 26504080	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16481735		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21212411, 22781316		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27234159	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	32363797	Associate	★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	32363797	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15735710, 15810954, 17327688, 17409396, 20457567, 21102433, 22922959, 28655790, 29143117, 29459323, 30855280, 31101877		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18577749		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27362942		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	30936982		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31257478	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19760520		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19760520	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	29192416	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29192416	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28599281		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	29206944	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	31411525		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31936664, 35163245, 36418859	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	32813135	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36899372	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29088003		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	26869017		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31005422		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30658667		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	27259755	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	15855650, 27798235	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30214039	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	18197262, 26360820	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30658667		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33737411	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	33737411	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27827359		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	38634365	Associate	★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	28707749		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29949786	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27466381		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23089909, 37587724	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30747487		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	19508974	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	9605742		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	9605742		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	30301260	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37809080	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28328747		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33144896	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	28553678		★☆☆☆☆ Found in Text Mining only