CD82 (CD82 molecule)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3732
• Gene name: CD82 molecule
• Gene symbol: CD82
• Synonyms (NCBI Gene): 4F9, C33, GR15, IA4, KAI1, R2, SAR2, ST6, TSPAN27
• Chromosome: 11
• Chromosome location: 11p11.2
• Summary: This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a

miRNA Show/Hide all (188)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054277	hsa-miR-362-3p	Luciferase reporter assay, qRT-PCR, Western blot	25652145
MIRT054277	hsa-miR-362-3p	Luciferase reporter assay, qRT-PCR, Western blot	25652145
MIRT054634	hsa-miR-197-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24613834
MIRT054634	hsa-miR-197-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24613834
MIRT650687	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT650686	hsa-miR-4294	HITS-CLIP	23824327
MIRT650685	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT650684	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT650683	hsa-miR-3672	HITS-CLIP	23824327
MIRT650682	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT650681	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650680	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT650679	hsa-miR-8055	HITS-CLIP	23824327
MIRT650678	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT054634	hsa-miR-197-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28252644
MIRT054634	hsa-miR-197-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28252644
MIRT650678	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT650679	hsa-miR-8055	HITS-CLIP	27418678
MIRT736194	hsa-miR-633	Luciferase reporter assay, Western blotting, qRT-PCR	33376521
MIRT650687	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT650686	hsa-miR-4294	HITS-CLIP	23824327
MIRT650685	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT650684	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT650683	hsa-miR-3672	HITS-CLIP	23824327
MIRT650682	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT650681	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650680	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT650679	hsa-miR-8055	HITS-CLIP	23824327
MIRT650678	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT876248	hsa-miR-4532	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT876253	hsa-miR-4772-3p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876256	hsa-miR-572	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876259	hsa-miR-106a	CLIP-seq
MIRT876260	hsa-miR-106b	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876261	hsa-miR-1234	CLIP-seq
MIRT876262	hsa-miR-150	CLIP-seq
MIRT876263	hsa-miR-17	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876264	hsa-miR-20a	CLIP-seq
MIRT876265	hsa-miR-20b	CLIP-seq
MIRT876266	hsa-miR-219-1-3p	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT876267	hsa-miR-302a	CLIP-seq
MIRT876268	hsa-miR-302b	CLIP-seq
MIRT876269	hsa-miR-302c	CLIP-seq
MIRT876270	hsa-miR-302d	CLIP-seq
MIRT876271	hsa-miR-302e	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876272	hsa-miR-372	CLIP-seq
MIRT876273	hsa-miR-373	CLIP-seq
MIRT876274	hsa-miR-3921	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT876275	hsa-miR-4639-5p	CLIP-seq
MIRT876276	hsa-miR-4653-5p	CLIP-seq
MIRT876277	hsa-miR-4682	CLIP-seq
MIRT876278	hsa-miR-4731-5p	CLIP-seq
MIRT876279	hsa-miR-4768-5p	CLIP-seq
MIRT876280	hsa-miR-512-3p	CLIP-seq
MIRT876281	hsa-miR-519d	CLIP-seq
MIRT876282	hsa-miR-520a-3p	CLIP-seq
MIRT876283	hsa-miR-520b	CLIP-seq
MIRT876284	hsa-miR-520c-3p	CLIP-seq
MIRT876285	hsa-miR-520d-3p	CLIP-seq
MIRT876286	hsa-miR-520e	CLIP-seq
MIRT876287	hsa-miR-520g	CLIP-seq
MIRT876288	hsa-miR-520h	CLIP-seq
MIRT876289	hsa-miR-571	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876290	hsa-miR-93	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT1921544	hsa-miR-3149	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT1921544	hsa-miR-3149	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT1921544	hsa-miR-3149	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876262	hsa-miR-150	CLIP-seq
MIRT1959688	hsa-miR-552	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT2196690	hsa-miR-1228	CLIP-seq
MIRT876262	hsa-miR-150	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT2196691	hsa-miR-3199	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT2196692	hsa-miR-3616-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT2196693	hsa-miR-377	CLIP-seq
MIRT2196694	hsa-miR-3927	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT2196695	hsa-miR-4436b-3p	CLIP-seq
MIRT876248	hsa-miR-4532	CLIP-seq
MIRT2196696	hsa-miR-4650-3p	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT2196697	hsa-miR-4690-3p	CLIP-seq
MIRT2196698	hsa-miR-4695-3p	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT2196699	hsa-miR-4721	CLIP-seq
MIRT2196700	hsa-miR-4736	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876287	hsa-miR-520g	CLIP-seq
MIRT876288	hsa-miR-520h	CLIP-seq
MIRT1959688	hsa-miR-552	CLIP-seq
MIRT2196701	hsa-miR-562	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT2196702	hsa-miR-764	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT2196698	hsa-miR-4695-3p	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq

Transcription factors Show/Hide all (6)

Transcription factor	Regulation	Reference
ATF3	Unknown	21454613
HDAC1	Repression	19182791
JUN	Activation	15580298
JUNB	Activation	15580298
TFAP2A	Activation	15580298
TP53	Activation	9736732

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15205336, 28030805, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	30463011
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1842498, 7754374
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337

Other IDs

• MIM: 600623
• HGNC: 6210
• e!Ensembl: ENSG00000085117

Protein

• UniProt ID: P27701
• Protein name: CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)
• Protein function: Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed:19497983). Participates thereby in diverse biological functions su
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00335	Tetraspanin	9 → 255	Tetraspanin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Lymphoid specific.
• Sequence:

  MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI
  GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGI
  VTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKG
  EEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAI
  IELLGMVLSICLCRHVHSEDYSKVPKY

• Sequence length: 267

Pathways

KEGG Pathway:

p53 signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (158)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29113211		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	8620488		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10551326, 25912735		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	18286698		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10582691		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15014022		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29113211		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	9828210		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15375577		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28030805		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17393418	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35795669	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11225981, 8806197, 8813131		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10767717, 10840154, 10936677, 14706010, 17982617, 20864363, 9815782		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15592684	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10873402, 10999724, 11431371, 17192874, 18712725, 19549254, 19656997, 22320993, 26708018, 28978052, 30306427, 30604894, 31759355, 9126478, 9736046		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	9570365	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15592684, 19549254, 32986351, 9570365, 9736046	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22320993, 27509988, 31759355, 32986351, 34207462	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9737661	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10873402, 11569927, 12955496, 19549254		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	10985391	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25889325	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25071074	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10767717, 10840154, 10936677, 14706010, 17982617, 20864363, 9815782		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10551326, 11212267, 16488391, 17308116, 17621632, 25912735, 8620488, 9552043		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31725636	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28030805	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19680475	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11696423	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34065085	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25428551		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10873402, 11606078, 25435431, 31725636		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11146234, 11696423, 26681053		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26681053		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11146234, 11696423, 26681053		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29113211		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	30862962		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	9828210		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	19303095, 20002769		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	20002769		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10568187, 10582691, 11802216, 12838318, 15259074, 21488189, 23873015, 9525743		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10568187, 10582691, 12530084, 15259074, 23873015, 26496979, 27053631, 28431527, 29222041		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12753720		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12838318, 24603753, 26408312, 27053631, 28431527, 33891491	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35942551	Inhibit	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20002769, 23957913, 28881668		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35795669	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17393418, 29980577		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33909846	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	19148553		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	16028840		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	24130172, 27041584		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16116605, 24130172, 25308734		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12684410, 18415123		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25308734	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21685244		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	11606078		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	10582691, 11696423, 12149507		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10098753, 30280774	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	12149507		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27764516		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27764516	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20944126, 22320990		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22320990	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	19303095		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	16028840, 19148553		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	20002769		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	22320990	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23696923, 23886139, 29187211		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25955299, 27417454	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30862962		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23233446, 25955299, 26592446, 27417454, 32203165, 34543390	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25955299, 27417454, 30862962		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	11895916, 15312688, 28260006		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11690710, 15237426, 18028322, 19666408, 24613834, 25071074, 31215741, 9828210, 9894767		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26132195, 34684727	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10098753, 26231404, 26681053, 27793161, 28431527, 30593175, 31725636, 31759355	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15259074, 29187211		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17504447, 23696923, 24758564, 25889325, 26408312, 29187211, 30280774	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	20944126, 22320990		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10873402, 10999724, 11431371, 16028840, 17192874, 18712725, 19549254, 19656997, 22320993, 26708018, 28978052, 30306427, 30604894, 31759355, 9126478, 9736046		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24130172, 25308734		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11696423, 9485031		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	9485031		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18028322, 9828210		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10551326, 11212267, 17308116, 19152459, 25912735, 8620488, 9552043		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	11895916, 15312688, 28260006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25435431		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11331321, 14601021, 15944768, 18286698, 21459729, 25051346, 25199507, 30948327, 31662449, 8895737, 9485031, 9671393, 9699525, 9736732, 9828210		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10353759, 10440748, 10582691, 10705204, 10913345, 10999724, 11431371, 11569927, 11572762, 11746826, 11895916, 12474542, 12806379, 15375577, 15580298, 16862154, 17406028, 21454613, 24130172, 27813113, 27926483, 28260006, 7754374, 8813131, 8895737, 9126478, 9254900, 9525743, 9575426, 9617345, 9831222		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17504447, 25652145, 28252644, 9485031, 9719466		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15375577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10582691, 10767717, 10840154, 10936677, 17982617, 20864363, 9815782		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10551326, 10767717, 10936677, 10999724, 11331321, 12576866, 12738793, 12806379, 12955496, 14706010, 15205336, 15375577, 15492270, 15618009, 15944768, 16271511, 16862154, 17308116, 17406028, 17621632, 18028322, 18712725, 19116362, 19224455, 19303095, 19549254, 19656997, 20123085, 20864363, 21168384, 23873025, 25119390, 25923697, 27041584, 27764516, 27813113, 27926483, 28030805, 28260006, 28431527, 28583320, 28978052, 29263677, 29283339, 30005669, 30189244, 30290593, 31408613, 8895737, 9485031, 9671393, 9699525, 9828210		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11146234, 11696423, 26681053		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10568187, 10582691, 11802216, 12838318, 21488189, 23873015, 9525743		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10999724, 19148553		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12579280, 15592684, 18712725		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10582691, 15375577, 19082457, 23873025, 24130172, 26199094, 26246476, 27041584, 9617345, 9671393		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	19082457		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26246476, 35942551	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27041584		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28368419		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	20075392		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16113057, 17210782, 18804164		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19755988	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	34543390	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28583320, 29755107		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10440748, 10551326, 10568187, 10582691, 10767717, 10779634, 10840154, 10873402, 10936677, 10964324, 11331321, 11696423, 11802216, 12120231, 12149507, 12167433, 12474542, 12576866, 12955496, 14612520, 14706010, 15237426, 15375577, 15944768, 15958618, 16488391, 16862154, 17982617, 18286698, 18712725, 19148553, 19166844, 19289568, 19303095, 19330835, 19549254, 19656997, 21454613, 21521534, 23617728, 23873025, 25119390, 25308734, 25435431, 25912735, 25955299, 26246476, 26681053, 27764516, 28260006, 28881668, 29464079, 29936782, 30280774, 30593175, 31759355, 31807237, 8620488, 8895737, 9485031, 9552043, 9617345, 9699525, 9719466, 9736046, 9736732, 9761121, 9894767		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12149507		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	12149507		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31483122		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11751509, 23102249, 29283339, 30290593, 30593175, 8620488		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10999724		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	29113211		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	18712725		★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	23957913		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11569927		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10873402, 25435431		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11696423	Inhibit	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	19303095		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11331321, 15944768, 18286698, 21459729, 25051346, 25199507, 30948327, 31662449, 8895737, 9485031, 9699525, 9828210		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28030805		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28030805, 31662449	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	19303095		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23617728		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29113211		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	9736732	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10440748, 10582691, 10705204, 10913345, 10999724, 11225981, 11431371, 11569927, 11572762, 11746826, 11895916, 12474542, 12806379, 15375577, 15580298, 16862154, 17406028, 21454613, 24130172, 27813113, 27926483, 28260006, 7754374, 8895737, 9254900, 9525743, 9617345, 9831222		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	8909232	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11572762, 7754374, 8806197, 9736732		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12474542, 12642901, 12738793, 12750295		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12738793, 31759355, 33204367, 8909232, 9570365	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27926483	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20002769, 23957913, 25597876, 28881668		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28356965		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17393418		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18037895, 18415123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	22228628		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	11569927		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11696423, 12167433, 21488189		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15996322, 18305955		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10964324, 30280774		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23696923, 23886139, 29187211	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24758564	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21488189		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12692839, 17504447, 25652145, 28252644, 9719466		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17504447, 21521534, 28252644	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27793161	Inhibit	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	9815782		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25071074	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15375577		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15375577		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15375577		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28978052		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	14706010	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11696423, 26681053	Inhibit	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CD82.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CD82.