Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	948
Gene name	CD36 molecule (CD36 blood group)
Gene symbol	CD36
Synonyms (NCBI Gene)	BDPLT10CHDS7FATGP3BGP4GPIVPASIVSCARB3
Chromosome	7
Chromosome location	7q21.11
Summary	The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhes

Show/Hide all (20)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1049673	C>G,T	Risk-factor	3 prime UTR variant, genic downstream transcript variant
rs1527483	G>A	Risk-factor	Intron variant
rs1761667	G>A	Risk-factor	Genic upstream transcript variant, intron variant
rs1984112	A>C,G,T	Risk-factor	Genic upstream transcript variant, intron variant
rs3211893	T>A,C,G	Likely-pathogenic	Splice donor variant
rs3211938	T>G	Risk-factor, pathogenic, benign	Coding sequence variant, stop gained, intron variant
rs70961716	AAAA>-,AAAAA	Likely-pathogenic	Frameshift variant, intron variant, coding sequence variant
rs75326924	C>T	Pathogenic	Intron variant, 5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant
rs121918035	A>C,G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs142186404	T>C,G	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs148051111	G>A,C	Likely-pathogenic, uncertain-significance	Splice donor variant
rs148910227	C>G,T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs550565800	ATTGTGCCTATT>-,ATTGTGCCTATTGTGCCTATT	Pathogenic-likely-pathogenic	Inframe deletion, inframe insertion, coding sequence variant, non coding transcript variant
rs551607784	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs572295823	CA>-	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant, non coding transcript variant
rs765809606	A>-,AA	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs766920034	->C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, intron variant, frameshift variant
rs771061715	AATAA>-	Likely-pathogenic	Non coding transcript variant, terminator codon variant, frameshift variant
rs1064795310	G>C	Likely-pathogenic	Splice acceptor variant
rs1064795836	G>C	Likely-pathogenic	Splice donor variant

293

Show/Hide all (293)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018933	hsa-miR-335-5p	Microarray	18185580
MIRT021050	hsa-miR-155-5p	Proteomics;Other	20584899
MIRT030109	hsa-miR-26b-5p	Microarray	19088304
MIRT609641	hsa-miR-8485	HITS-CLIP	23313552
MIRT616399	hsa-miR-8064	HITS-CLIP	23313552
MIRT609641	hsa-miR-8485	HITS-CLIP	23313552
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT671345	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT671345	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT514954	hsa-miR-4438	PAR-CLIP	23446348
MIRT514953	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT514952	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514951	hsa-miR-1254	PAR-CLIP	23446348
MIRT514950	hsa-miR-3116	PAR-CLIP	23446348
MIRT514949	hsa-miR-661	PAR-CLIP	23446348
MIRT514948	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT514946	hsa-miR-5095	PAR-CLIP	23446348
MIRT514947	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514945	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514944	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT575268	hsa-miR-448	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT732664	hsa-miR-145-5p	Luciferase reporter assayqRT-PCR	33517563
MIRT732664	hsa-miR-145-5p	Luciferase reporter assayqRT-PCR	33517563
MIRT575271	hsa-miR-8485	HITS-CLIP	23313552
MIRT575269	hsa-miR-8064	HITS-CLIP	23313552
MIRT575271	hsa-miR-8485	HITS-CLIP	23313552
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575270	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575270	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT514954	hsa-miR-4438	PAR-CLIP	23446348
MIRT514953	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT514952	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514951	hsa-miR-1254	PAR-CLIP	23446348
MIRT514950	hsa-miR-3116	PAR-CLIP	23446348
MIRT514949	hsa-miR-661	PAR-CLIP	23446348
MIRT514948	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT514946	hsa-miR-5095	PAR-CLIP	23446348
MIRT514947	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514945	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514944	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT875165	hsa-miR-1193	CLIP-seq
MIRT875166	hsa-miR-146a	CLIP-seq
MIRT875167	hsa-miR-146b-5p	CLIP-seq
MIRT875168	hsa-miR-155	CLIP-seq
MIRT875169	hsa-miR-197	CLIP-seq
MIRT875170	hsa-miR-1972	CLIP-seq
MIRT875171	hsa-miR-1976	CLIP-seq
MIRT875172	hsa-miR-2392	CLIP-seq
MIRT875173	hsa-miR-3129-3p	CLIP-seq
MIRT875174	hsa-miR-3163	CLIP-seq
MIRT875175	hsa-miR-3173-3p	CLIP-seq
MIRT875176	hsa-miR-338-5p	CLIP-seq
MIRT875177	hsa-miR-3529	CLIP-seq
MIRT875178	hsa-miR-374c	CLIP-seq
MIRT875179	hsa-miR-379	CLIP-seq
MIRT875180	hsa-miR-3942-3p	CLIP-seq
MIRT875181	hsa-miR-3975	CLIP-seq
MIRT875182	hsa-miR-4266	CLIP-seq
MIRT875183	hsa-miR-4320	CLIP-seq
MIRT875184	hsa-miR-4328	CLIP-seq
MIRT875185	hsa-miR-4428	CLIP-seq
MIRT875186	hsa-miR-4435	CLIP-seq
MIRT875187	hsa-miR-4451	CLIP-seq
MIRT875188	hsa-miR-4536	CLIP-seq
MIRT875189	hsa-miR-4633-3p	CLIP-seq
MIRT875190	hsa-miR-4650-3p	CLIP-seq
MIRT875191	hsa-miR-4666-3p	CLIP-seq
MIRT875192	hsa-miR-4691-3p	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT875194	hsa-miR-4695-5p	CLIP-seq
MIRT875195	hsa-miR-4701-5p	CLIP-seq
MIRT875196	hsa-miR-4716-5p	CLIP-seq
MIRT875197	hsa-miR-4729	CLIP-seq
MIRT875198	hsa-miR-4781-3p	CLIP-seq
MIRT875199	hsa-miR-4796-3p	CLIP-seq
MIRT875200	hsa-miR-4797-5p	CLIP-seq
MIRT875201	hsa-miR-4803	CLIP-seq
MIRT875202	hsa-miR-5096	CLIP-seq
MIRT875203	hsa-miR-520g	CLIP-seq
MIRT875204	hsa-miR-520h	CLIP-seq
MIRT875205	hsa-miR-548n	CLIP-seq
MIRT875206	hsa-miR-548s	CLIP-seq
MIRT875207	hsa-miR-548t	CLIP-seq
MIRT875208	hsa-miR-577	CLIP-seq
MIRT875209	hsa-miR-588	CLIP-seq
MIRT875210	hsa-miR-640	CLIP-seq
MIRT875211	hsa-miR-651	CLIP-seq
MIRT875212	hsa-miR-655	CLIP-seq
MIRT875213	hsa-miR-765	CLIP-seq
MIRT1959473	hsa-miR-1207-3p	CLIP-seq
MIRT1959474	hsa-miR-122	CLIP-seq
MIRT1959475	hsa-miR-1226	CLIP-seq
MIRT1959476	hsa-miR-2355-3p	CLIP-seq
MIRT1959477	hsa-miR-3121-5p	CLIP-seq
MIRT1959478	hsa-miR-3135b	CLIP-seq
MIRT1959479	hsa-miR-3199	CLIP-seq
MIRT1959480	hsa-miR-3647-3p	CLIP-seq
MIRT1959481	hsa-miR-3652	CLIP-seq
MIRT1959482	hsa-miR-4430	CLIP-seq
MIRT1959483	hsa-miR-450b-5p	CLIP-seq
MIRT1959484	hsa-miR-4652-3p	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT1959485	hsa-miR-4733-3p	CLIP-seq
MIRT1959486	hsa-miR-4740-3p	CLIP-seq
MIRT1959487	hsa-miR-4766-5p	CLIP-seq
MIRT1959488	hsa-miR-646	CLIP-seq
MIRT1959489	hsa-miR-676	CLIP-seq
MIRT875165	hsa-miR-1193	CLIP-seq
MIRT1959473	hsa-miR-1207-3p	CLIP-seq
MIRT1959474	hsa-miR-122	CLIP-seq
MIRT1959475	hsa-miR-1226	CLIP-seq
MIRT2196457	hsa-miR-1915	CLIP-seq
MIRT2196458	hsa-miR-2115	CLIP-seq
MIRT875172	hsa-miR-2392	CLIP-seq
MIRT1959478	hsa-miR-3135b	CLIP-seq
MIRT2196459	hsa-miR-3155	CLIP-seq
MIRT2196460	hsa-miR-3155b	CLIP-seq
MIRT1959481	hsa-miR-3652	CLIP-seq
MIRT2196461	hsa-miR-4264	CLIP-seq
MIRT2196462	hsa-miR-4277	CLIP-seq
MIRT2196463	hsa-miR-4420	CLIP-seq
MIRT1959482	hsa-miR-4430	CLIP-seq
MIRT875186	hsa-miR-4435	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT875195	hsa-miR-4701-5p	CLIP-seq
MIRT875196	hsa-miR-4716-5p	CLIP-seq
MIRT2196464	hsa-miR-4726-3p	CLIP-seq
MIRT1959485	hsa-miR-4733-3p	CLIP-seq
MIRT2196465	hsa-miR-4772-3p	CLIP-seq
MIRT875198	hsa-miR-4781-3p	CLIP-seq
MIRT2196466	hsa-miR-4797-3p	CLIP-seq
MIRT2196467	hsa-miR-484	CLIP-seq
MIRT2196468	hsa-miR-516a-3p	CLIP-seq
MIRT2196469	hsa-miR-539	CLIP-seq
MIRT875206	hsa-miR-548s	CLIP-seq
MIRT875209	hsa-miR-588	CLIP-seq
MIRT1959488	hsa-miR-646	CLIP-seq
MIRT2385741	hsa-miR-128	CLIP-seq
MIRT2385742	hsa-miR-140-3p	CLIP-seq
MIRT2385743	hsa-miR-148a	CLIP-seq
MIRT2385744	hsa-miR-148b	CLIP-seq
MIRT2385745	hsa-miR-152	CLIP-seq
MIRT2446587	hsa-miR-3156-5p	CLIP-seq
MIRT2446588	hsa-miR-3200-5p	CLIP-seq
MIRT2446589	hsa-miR-339-5p	CLIP-seq
MIRT2446590	hsa-miR-4477a	CLIP-seq
MIRT2446591	hsa-miR-4682	CLIP-seq
MIRT2446592	hsa-miR-4742-3p	CLIP-seq
MIRT2499480	hsa-miR-1228	CLIP-seq
MIRT2499481	hsa-miR-1263	CLIP-seq
MIRT2499482	hsa-miR-1269	CLIP-seq
MIRT2499483	hsa-miR-1269b	CLIP-seq
MIRT2499484	hsa-miR-203	CLIP-seq
MIRT2499485	hsa-miR-223	CLIP-seq
MIRT2499486	hsa-miR-329	CLIP-seq
MIRT2499487	hsa-miR-362-3p	CLIP-seq
MIRT875178	hsa-miR-374c	CLIP-seq
MIRT2499488	hsa-miR-3941	CLIP-seq
MIRT2499489	hsa-miR-4529-3p	CLIP-seq
MIRT2499490	hsa-miR-4697-3p	CLIP-seq
MIRT2499491	hsa-miR-4760-3p	CLIP-seq
MIRT2499492	hsa-miR-548a-3p	CLIP-seq
MIRT2499493	hsa-miR-548ae	CLIP-seq
MIRT2499494	hsa-miR-548aj	CLIP-seq
MIRT2499495	hsa-miR-548am	CLIP-seq
MIRT2499496	hsa-miR-548e	CLIP-seq
MIRT2499497	hsa-miR-548f	CLIP-seq
MIRT2499498	hsa-miR-548x	CLIP-seq
MIRT2499499	hsa-miR-603	CLIP-seq
MIRT875212	hsa-miR-655	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
PPARA	Unknown	16713233;20110263
PPARG	Activation	11795270
PPARG	Unknown	15104237;17322100
RUNX3	Repression	16887969

179

Show/Hide all (179)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000165	Process	MAPK cascade	IEA
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001540	Function	Amyloid-beta binding	IDA	29518356
GO:0001540	Function	Amyloid-beta binding	TAS	20037584
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IDA	17416590
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	TAS	29111364
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IBA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IEA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IMP	10772654
GO:0005041	Function	Low-density lipoprotein particle receptor activity	TAS	9568716
GO:0005044	Function	Scavenger receptor activity	IBA
GO:0005044	Function	Scavenger receptor activity	IMP	18941241
GO:0005044	Function	Scavenger receptor activity	TAS	11240025, 29111364
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	TAS
GO:0005515	Function	Protein binding	IPI	16880211, 18773118, 20037584, 23640500, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	22022213, 24503477
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2468669, 9568716
GO:0005901	Component	Caveola	IBA
GO:0006629	Process	Lipid metabolic process	NAS	7518447
GO:0006631	Process	Fatty acid metabolic process	TAS	29111364
GO:0006869	Process	Lipid transport	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IBA
GO:0006898	Process	Receptor-mediated endocytosis	IMP	18941241
GO:0006910	Process	Phagocytosis, recognition	IEA
GO:0006911	Process	Phagocytosis, engulfment	TAS	29111364
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2468670
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007596	Process	Blood coagulation	TAS	2468670
GO:0008035	Function	High-density lipoprotein particle binding	IEA
GO:0008289	Function	Lipid binding	IDA	10772654
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	10772654
GO:0009986	Component	Cell surface	ISS
GO:0009986	Component	Cell surface	TAS	29111364
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IMP	10772654
GO:0010886	Process	Positive regulation of cholesterol storage	IEA
GO:0015636	Function	Short-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0015909	Process	Long-chain fatty acid transport	IMP	21395585
GO:0015911	Process	Long-chain fatty acid import across plasma membrane	IDA	24503477
GO:0015912	Process	Short-chain fatty acid transport	IMP	21395585
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2468669
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23896411
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23896411
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0019915	Process	Lipid storage	IBA
GO:0019915	Process	Lipid storage	IEA
GO:0019915	Process	Lipid storage	IMP	10772654
GO:0019934	Process	CGMP-mediated signaling	IDA	17416590
GO:0030169	Function	Low-density lipoprotein particle binding	IBA
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	10772654
GO:0030169	Function	Low-density lipoprotein particle binding	IEA
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030299	Process	Intestinal cholesterol absorption	IEA
GO:0030299	Process	Intestinal cholesterol absorption	ISS
GO:0030301	Process	Cholesterol transport	IEA
GO:0030301	Process	Cholesterol transport	ISS	12376530
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0031526	Component	Brush border membrane	IEA
GO:0031526	Component	Brush border membrane	ISS
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	TAS	29111364
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0033993	Process	Response to lipid	IEA
GO:0033993	Process	Response to lipid	ISS
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IGI	20037584
GO:0034197	Process	Triglyceride transport	IEA
GO:0034197	Process	Triglyceride transport	ISS
GO:0034381	Process	Plasma lipoprotein particle clearance	IEA
GO:0034381	Process	Plasma lipoprotein particle clearance	ISS	12376530
GO:0034383	Process	Low-density lipoprotein particle clearance	IBA
GO:0034383	Process	Low-density lipoprotein particle clearance	IEA
GO:0034383	Process	Low-density lipoprotein particle clearance	IMP	10772654
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035325	Function	Toll-like receptor binding	IPI	20037584
GO:0035579	Component	Specific granule membrane	TAS
GO:0035634	Process	Response to stilbenoid	IEA
GO:0038024	Function	Cargo receptor activity	IDA	32958780
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	IDA	17416590
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042953	Process	Lipoprotein transport	IBA
GO:0042953	Process	Lipoprotein transport	IEA
GO:0042953	Process	Lipoprotein transport	IMP	10772654
GO:0042953	Process	Lipoprotein transport	TAS	9568716
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IGI	20037584
GO:0043235	Component	Receptor complex	IPI	20037584
GO:0043254	Process	Regulation of protein-containing complex assembly	IMP	20037584
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0044539	Process	Long-chain fatty acid import into cell	IBA
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	17416590, 22022213
GO:0044539	Process	Long-chain fatty acid import into cell	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	29518356
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045121	Component	Membrane raft	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0045335	Component	Phagocytic vesicle	TAS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IDA	23896411
GO:0050431	Function	Transforming growth factor beta binding	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050892	Process	Intestinal absorption	IEA
GO:0050892	Process	Intestinal absorption	ISS
GO:0050909	Process	Sensory perception of taste	IEA
GO:0050909	Process	Sensory perception of taste	ISS
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IEA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070053	Function	Thrombospondin receptor activity	IDA	9245797
GO:0070053	Function	Thrombospondin receptor activity	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070508	Process	Cholesterol import	IEA
GO:0070508	Process	Cholesterol import	ISS
GO:0070542	Process	Response to fatty acid	IEA
GO:0070542	Process	Response to fatty acid	ISS
GO:0070543	Process	Response to linoleic acid	IEA
GO:0070543	Process	Response to linoleic acid	ISS
GO:0070892	Function	Lipoteichoic acid immune receptor activity	IEA
GO:0071221	Process	Cellular response to bacterial lipopeptide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0071447	Process	Cellular response to hydroperoxide	IEA
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	ISS
GO:0071813	Function	Lipoprotein particle binding	IDA	9568716
GO:0071944	Component	Cell periphery	IDA	26449856
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0098900	Process	Regulation of action potential	IEA
GO:0098900	Process	Regulation of action potential	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25596128
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	27607416
GO:0150024	Process	Oxidised low-density lipoprotein particle clearance	IMP	27607416
GO:0150025	Function	Oxidised low-density lipoprotein particle receptor activity	IMP	27607416
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IBA
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IMP	18941241
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901480	Function	Oleate transmembrane transporter activity	IDA	24503477
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	31649195
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:1990000	Process	Amyloid fibril formation	IEA
GO:1990000	Process	Amyloid fibril formation	ISS
GO:1990379	Process	Lipid transport across blood-brain barrier	IMP	21395585
GO:2000121	Process	Regulation of removal of superoxide radicals	IEA
GO:2000334	Process	Positive regulation of blood microparticle formation	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
173510	1663	ENSG00000135218

P16671

Protein name

Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)

Protein function

Multifunctional glycoprotein that acts as a receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipopr

PDB

5LGD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01130	CD36	14 → 463	CD36 family	Family

Sequence

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Sequence length

472

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CD36-related disorder	Likely pathogenic; Pathogenic	rs748431584, rs753754773, rs2535905306, rs550565800, rs375042355, rs1451278617, rs775734577, rs772709798, rs753791074, rs2535739173, rs148051111, rs148910227	RCV003324407 RCV004741075 RCV004550744 RCV003330584 RCV004552511 View all (7 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Coronary heart disease, susceptibility to, 7	Likely pathogenic; Pathogenic	rs775478465, rs572295823, rs148051111, rs3211901	RCV004796600 RCV002503831 RCV000477879 RCV005047030	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Inherited bleeding disorder, platelet-type	Likely pathogenic	rs201765331	RCV004017735	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malaria, susceptibility to	Likely pathogenic; Pathogenic	rs775478465, rs572295823, rs148051111, rs766920034, rs3211901	RCV004796600 RCV002503831 RCV000477879 RCV000714683 RCV005047030	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Melanoma	Likely pathogenic	rs3211901	RCV005897387	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nonpapillary renal cell carcinoma	Likely pathogenic	rs375042355	RCV005932783	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Platelet-type bleeding disorder 10	Likely pathogenic; Pathogenic	rs775478465, rs748431584, rs199530093, rs757142781, rs375042355, rs753754773, rs780525946, rs149985988, rs754478799, rs751804837, rs572295823, rs550565800, rs574416705, rs1796684604, rs748289963 View all (12 more)	RCV001594440 RCV005230489 RCV005360334 RCV001780738 RCV005365640 View all (23 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Sarcoma	Likely pathogenic	rs375042355	RCV005939728	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (33)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD PLATELET DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC-UREMIC SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	-; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, cerebral, susceptibility to	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopetrosis	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEMPHIGUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature coronary artery atherosclerosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 2 diabetes mellitus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (258)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22763563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28521628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	LHGDN	17071479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30843336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29483963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	31484922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	30065793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	36583008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult-onset citrullinemia type 2	Citrullinemia	BEFREE	25533124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	18288886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	20157514, 27693409, 28557591, 28598597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30092300		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	28939159		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	28939159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30235742, 35768560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	14600428, 19849713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24702189, 28150942, 29871926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28089071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	19413744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia hypochromic microcytic	Hypochromic microcytic anemia	Pubtator	19359777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	27869039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	31185924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31605325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antibody Deficiency Syndrome	Antibody Deficiency Syndrome	CTD_human_DG	15690042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	23817509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30210081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30092300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	27869039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10865832, 10953027, 11048891, 11433350, 11795270, 11884283, 12238639, 14720468, 15022174, 15753136, 16075051, 16313757, 16822947, 16959872, 18497330 View all (60 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	LHGDN	14684613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29886733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28667161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40450010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	9040027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10865832, 10953027, 11048891, 11433350, 11795270, 11884283, 12238639, 14720468, 15022174, 15753136, 16075051, 16313757, 16822947, 16959872, 18497330 View all (59 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12419963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15979077, 16952981, 19065049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	30905589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19144874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16402135, 17938632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	17910626, 18431509, 20680227, 23966019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	CLINVAR_DG	10946357, 11019968, 11718687, 11950861, 15282206, 24917573, 24960640, 25798958, 7533783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Platelet Disorders	Platelet-type bleeding disorder	BEFREE	22271903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Platelet Disorders	Platelet disorder	Pubtator	30721642	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	7532148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15390180, 25172842, 25633981, 26825466, 27974793, 29914089, 30573731, 30826489, 31739580, 31806729, 31825825, 31847105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	31326577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27974793, 29663931, 31484922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26424075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29969695, 31739580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29398710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	12419963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30518717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	10981864		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	9040027		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	10981864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30506990, 31249632, 9040027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11602321, 17466567, 19016618, 20551015, 23844572, 25277110, 27460265, 30177273, 31344026, 31373231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15282206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	18497330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	28866086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	28804718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11323022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10339462, 20935172, 21228186, 22901552, 24691441		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30213558, 31655604		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	30213558, 31655604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	28634191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	28634191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31722350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	21931561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28536108, 28919632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29765537		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29111364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	22342341, 28883843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35768560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	9863008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15780035, 15860439, 29733876, 30521471, 31484922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36074971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28697919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22701570, 28062415, 29490017, 30104639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31089396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16252156, 17924847, 18067591, 20935172, 22993001, 25299084, 27995417, 28691408, 30218892, 31185924, 31748580, 9852639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10744142, 17924847, 18067591, 20935172, 22113854, 22993001, 23856131, 25299084, 27995417, 28691408, 30218892, 30564122, 31185924, 31748580, 9852639		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	22113854, 25118627, 31185924	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	25299084, 27461004	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	17924847, 18067591, 20935172, 22993001, 25118627, 25299084, 27461004, 27995417, 28691408, 30218892, 31185924, 31748580, 9852639		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	18067591		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	36608744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19342682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20174623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	17374397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	11433350, 12540964, 12618277, 15221799, 15915335, 16911630, 19185504, 19190027, 21454644, 22662181, 22869067, 23844572, 24069322, 28883843, 29274335 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11433350, 12540964, 12618277, 15221799, 15915335, 16911630, 19185504, 19190027, 21454644, 22662181, 22869067, 23844572, 24069322, 27013613, 27912197 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	12618277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22113854, 25132069, 25299084, 33966442, 35666553, 36031603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18305138, 22194967, 32198214, 33966442, 33989714, 36031603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24148348, 29344829, 31647139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12618277, 15221799, 15277394, 15671915, 16313757, 16911630, 18305138, 20551015, 20966915, 21250778, 21262584, 21808142, 23844572, 24018334, 24069322 View all (15 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30506990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15737001, 30388276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	12540964, 12938014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12517778, 14767533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	28457935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	11891508, 17640331, 17721545, 23247049, 28775078, 30825500, 31261174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35274685, 35552711, 35666553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19606481, 20035060, 30843336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	29371918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29111364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	23792019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	20157514, 22275803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21270117, 23640498, 23964120, 27163748, 27497686, 27593674, 27967209, 28038998, 28270609, 28366540, 29452209, 29705240, 30662007, 31292134, 31394746, 31599493 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20303349, 21270117, 27967209, 29705240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	1703153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30016988, 31652636		★★★★★ ★☆☆☆☆ Found in Text Mining only
FNAITP	Fetal and neonatal alloimmune thrombocytopenia	BEFREE	28815406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	10772961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25358253, 27536856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25358253, 27536856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	15010364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	11844979, 12224819, 18305138, 19185504, 21250778, 25118627, 28111291, 9839487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	18305138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	18305138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22701570, 28062415, 29490017, 30104639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hennekam lymphangiectasia-lymphedema syndrome	Hennekam lymphangiectasia-lymphedema syndrome	BEFREE	28488382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	BEFREE	16493488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	29428312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	16252156, 22993001, 23247049, 25875611, 28677864, 30218892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11433350, 12618277, 23316693, 28729885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31373231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21270117, 26085100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	14684613, 16670819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	17043800, 17721545, 28500736, 29130531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	16219805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	LHGDN	16219805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30924431, 31185924	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	11140856, 11891508, 15209533, 22042811, 22869067, 25723554, 29806605, 30924431, 31185924, 31748580		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	16670819		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	18587397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	9040027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	21346626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	20947105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29111822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17496152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15690042, 23204179, 27974793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	CTD_human_DG	15690042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22342341, 24702189, 28883843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	26252872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	LHGDN	17572512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23119050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32033224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24784828, 33966442	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	12544734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30230367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31722350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	27530817		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28521628, 7511332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16095690, 28416471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17325662, 27974793, 31603606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	23770802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26424075, 26831370, 30231922, 31358770, 31376682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22648712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29969695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19144874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19144874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19144874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19144874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	28521628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	20157514, 22275803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	17938632		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	17938632		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	17938632		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	17938632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	28912804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	31022903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15390180, 25172842, 25633981, 26825466, 27974793, 29914089, 30573731, 30826489, 31739580, 31806729, 31825825, 31847105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29562615, 29969695, 31739580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17325662, 27974793, 31603606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29398710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29483963, 31393490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30728288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30702489, 30717785, 31262715, 31410220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11710837, 17081814, 23076869, 28303381, 28416471, 30069479, 30728288, 31022903, 31410189, 31605325, 31739580, 9863008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30213558, 31655604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	9863008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15050739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	31022903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	24069322		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12664607		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mental Depression	Mental Depression	BEFREE	20174623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	11844979, 27525284, 28712872, 29705240, 29883404, 30143599, 30825500, 30924431, 31701685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	20966915, 32898636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18305138, 20223461, 22047506, 30724038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11718687, 11891508, 15209533, 16911630, 17339535, 18305138, 19185504, 20223461, 20935172, 21250778, 22047506, 22456541, 22588808, 22662181, 23249574 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	16563568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	8695798		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11053613, 22271903, 27758818, 8695798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10468872, 15874887, 17619827, 22627583, 28860151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17619827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18035074, 22113854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30894181		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neonatal Alloimmune Thrombocytopenia	Alloimmune Thrombocytopenia	BEFREE	12430674, 18462250, 27914736, 29030871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12664607, 1703153, 17081814, 17325662, 19126244, 22777768, 23770802, 28186980, 29398710, 29483963, 29663931, 29914089, 29969695, 30207797, 30573731 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30258045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	31739580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	15737001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21270117, 25102981, 27916988, 28770225, 29452209, 30321786, 31034016, 31358770, 31480575, 31805072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31462892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	20408954, 21270117, 25474087, 27967209, 29705240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11844979, 15168018, 16451133, 18263877, 19016618, 19223519, 19893500, 20427507, 20966904, 21250778, 21912245, 22240721, 22248592, 22253914, 25555908 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19893500, 21285405, 22113854, 22210925, 23175350, 26556365, 32198214, 32419652, 32685140, 34448000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30724038	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	33612620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	20427507, 30724038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30573731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ophthalmoplegia Chronic Progressive External	Progressive external ophthalmoplegia	Pubtator	21515672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	14719070, 29540257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	14719070		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29398710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29483963, 31393490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31605325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31036561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23281097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27753178, 29520779, 30597558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	25095746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	10504124, 11545201, 11602321, 11686358, 11844979, 15912310, 16099393, 18462250, 19403559, 23966019, 24903227, 24960640, 25330908, 26528880, 27013613 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	CLINVAR_DG	10946357, 11019968, 11352982, 11499670, 11950861, 12971464, 16493488, 23966019, 25330908, 25798958, 26528880, 7515716, 7533783, 7686693, 8696942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	UNIPROT_DG	11950861, 7533783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	20010302		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	27013613, 29380239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	18000176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29428312, 30322386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17980427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	23817509, 31654747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	16451133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28521628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30728288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	12805087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29952218, 31461627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28919632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23739280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22765916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28240319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	23077215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17325662, 31603606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20303349, 21270117, 23383656, 23640498, 23964120, 25474087, 27034954, 27163748, 27497686, 27593674, 27799461, 27967209, 28038998, 28270609, 28366540 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30702489, 30717785, 31262715, 31410220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30762013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29562615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28456717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	30721642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TOE SYNDACTYLY, TELECANTHUS, AND ANOGENITAL AND RENAL MALFORMATIONS	Toe Syndactyly, Telecanthus, And Anogenital And Renal Malformations	BEFREE	30925464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Van Maldergem Wetzburger Verloes syndrome	Cerebrofacioarticular Syndrome	BEFREE	28488382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30567481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin E Deficiency	Vitamin E Deficiency	BEFREE	16407258		★★★★★ ★☆☆☆☆ Found in Text Mining only

CD36 (CD36 molecule (CD36 blood group))