CD300C (CD300c molecule)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10871
• Gene name: CD300c molecule
• Gene symbol: CD300C
• Synonyms (NCBI Gene): CLM-6, CMRF-35, CMRF-35A, CMRF35, CMRF35-A1, CMRF35A, CMRF35A1, IGSF16, LIR
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018122	hsa-miR-335-5p	Microarray	18185580
MIRT874866	hsa-miR-4491	CLIP-seq
MIRT874867	hsa-miR-4657	CLIP-seq
MIRT874868	hsa-miR-4719	CLIP-seq
MIRT874869	hsa-miR-4768-3p	CLIP-seq
MIRT874870	hsa-miR-576-3p	CLIP-seq
MIRT874871	hsa-miR-665	CLIP-seq
MIRT2196394	hsa-miR-3918	CLIP-seq
MIRT2196395	hsa-miR-4694-3p	CLIP-seq
MIRT2196396	hsa-miR-512-5p	CLIP-seq
MIRT2196397	hsa-miR-545	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	1349532
GO:0005515	Function	Protein binding	IPI	20959446, 22291008, 29051512, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1349532
GO:0006968	Process	Cellular defense response	TAS	1349532
GO:0007165	Process	Signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0045088	Process	Regulation of innate immune response	IBA

Other IDs

• MIM: 606786
• HGNC: 19320
• e!Ensembl: ENSG00000167850

Protein

• UniProt ID: Q08708
• Protein name: CMRF35-like molecule 6 (CLM-6) (CD300 antigen-like family member C) (CMRF35-A1) (CMRF-35) (Immunoglobulin superfamily member 16) (IgSF16) (CD antigen CD300c)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	26 → 129	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Present on the surface of monocytes, neutrophils, a proportion of peripheral blood T- and B-lymphocytes and lymphocytic cell lines.
• Sequence:

  MTARAWASWRSSALLLLLVPGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPP
  QILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDF
  HDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFS
  NVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ

• Sequence length: 224

Pathways

Reactome Pathway:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Related Genes

No strongly related genes found yet for CD300C.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CD300C.