CD177 (CD177 molecule)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57126
• Gene name: CD177 molecule
• Gene symbol: CD177
• Synonyms (NCBI Gene): HNA-2a, HNA2A, NB1, NB1 GP, PRV-1, PRV1
• Chromosome: 19
• Chromosome location: 19q13.31
• Summary: This gene encodes a glycosyl-phosphatidylinositol (GPI)-linked cell surface glycoprotein that plays a role in neutrophil activation. The protein can bind platelet endothelial cell adhesion molecule-1 and function in neutrophil transmigration. Mutations in

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018643	hsa-miR-335-5p	Microarray	18185580
MIRT873978	hsa-miR-361-5p	CLIP-seq
MIRT873979	hsa-miR-4313	CLIP-seq
MIRT873980	hsa-miR-4434	CLIP-seq
MIRT873981	hsa-miR-4516	CLIP-seq
MIRT873982	hsa-miR-4531	CLIP-seq
MIRT873983	hsa-miR-4691-3p	CLIP-seq
MIRT873984	hsa-miR-4691-5p	CLIP-seq
MIRT873985	hsa-miR-4717-3p	CLIP-seq
MIRT873986	hsa-miR-4802-3p	CLIP-seq
MIRT873987	hsa-miR-483-3p	CLIP-seq
MIRT873988	hsa-miR-539	CLIP-seq
MIRT873989	hsa-miR-605	CLIP-seq
MIRT2196184	hsa-miR-4280	CLIP-seq

Gene ontology (GO) Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	17244676, 28240246
GO:0002376	Process	Immune system process	IEA
GO:0005178	Function	Integrin binding	IPI	21193407, 28807980
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	12675722, 17244676, 18462208, 21193407, 22266279, 23461681, 24926686, 27227454, 28240246, 28807980
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IMP	28807980
GO:0007159	Process	Leukocyte cell-cell adhesion	IBA
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	17580308
GO:0016020	Component	Membrane	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030100	Process	Regulation of endocytosis	IDA	28807980
GO:0030667	Component	Secretory granule membrane	IDA	18462208
GO:0032930	Process	Positive regulation of superoxide anion generation	IGI	21193407
GO:0034394	Process	Protein localization to cell surface	IMP	17244676, 18462208
GO:0035579	Component	Specific granule membrane	TAS
GO:0042995	Component	Cell projection	IEA
GO:0043315	Process	Positive regulation of neutrophil degranulation	IBA
GO:0043315	Process	Positive regulation of neutrophil degranulation	IGI	21193407
GO:0044853	Component	Plasma membrane raft	IBA
GO:0044853	Component	Plasma membrane raft	IDA	21193407
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045217	Process	Cell-cell junction maintenance	IBA
GO:0045217	Process	Cell-cell junction maintenance	IMP	23202369
GO:0048306	Function	Calcium-dependent protein binding	IPI	17580308
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070821	Component	Tertiary granule membrane	IDA	18462208
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0072672	Process	Neutrophil extravasation	IMP	17580308, 22266279
GO:0098552	Component	Side of membrane	IEA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IMP	17580308
GO:1990266	Process	Neutrophil migration	IMP	28240246
GO:1990266	Process	Neutrophil migration	IMP	28807980
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	IBA
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	IMP	28807980

Other IDs

• MIM: 162860
• HGNC: 30072
• e!Ensembl: ENSG00000204936

Protein

• UniProt ID: Q8N6Q3
• Protein name: CD177 antigen (Human neutrophil alloantigen 2a) (HNA-2a) (NB1 glycoprotein) (NB1 GP) (Polycythemia rubra vera protein 1) (PRV-1) (CD antigen CD177)
• Protein function: In association with beta-2 integrin heterodimer ITGAM/CD11b and ITGB2/CD18, mediates activation of TNF-alpha primed neutrophils including degranulation and superoxide production (PubMed:21193407). In addition, by preventing beta-2 integrin inter
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00021	UPAR_LY6	133 → 210	u-PAR/Ly-6 domain	Domain
  PF00021	UPAR_LY6	325 → 403	u-PAR/Ly-6 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in normal bone marrow and weakly expressed in fetal liver (PubMed:10753836). During neutrophil differentiation, expression begins at the metamyelocyte stage and continues throughout the subsequent stages (at protein le
• Sequence:

  MSAVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLM
  LIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLW
  APQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCM
  PQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEV
  GQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCN
  SASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSG
  GGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGGGAEGLESLTWGV
  GLALAPALWWGVVCPSC

• Sequence length: 437

Pathways

Reactome Pathway

Common Pathway of Fibrin Clot Formation

Cell surface interactions at the vascular wall

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (91)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alloimmunisation	Alloimmunisation	BEFREE	12010833, 17845901		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	1692888		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29738769		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	40489880	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28559244		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28559244	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	1692888		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	18324972		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	18324972	Stimulate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	18324972		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24870032		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	2217169	Associate	★☆☆☆☆ Found in Text Mining only
CAMPOMELIC DYSPLASIA	Campomelic Dysplasia	BEFREE	15327515		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33302660	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23521917	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	40489880	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	40489880	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	31509227		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	12730106, 14701686, 15327515, 15572213, 15985544, 16919893, 17852451, 22300941		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29228136		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28981629	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29228136, 30377339		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27644655, 37528394, 40003985	Associate	★☆☆☆☆ Found in Text Mining only
CRANIOMETAPHYSEAL DYSPLASIA, AUTOSOMAL DOMINANT	Craniometaphyseal Dysplasia	BEFREE	15327515		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	35212366	Associate	★☆☆☆☆ Found in Text Mining only
Erythroid hyperplasia	Erythroid hyperplasia	BEFREE	10582341		★☆☆☆☆ Found in Text Mining only
Familial thrombocytosis	Thrombocytosis	BEFREE	12730106		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	31093484		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	38213873	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	172531, 181751	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24267296		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35212366	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10753836		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	26024230	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	17845901, 27905683		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24696502	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19404956	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36532018	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24870032		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16161153		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23899160		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29228136, 8308290		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30674924		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	30674924	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	30943984	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	8872899		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12377969		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15327515	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	12377969, 15327515, 22300941		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10753836, 12377969		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	12730106, 15749676, 16197445, 17976520, 26024230		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	17980909		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	15985544, 17852451, 26024230	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30230250		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21478825, 28428279, 7691154		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22253825		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22253825	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	11465086, 17845901, 27905683		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	12010833, 12623849, 23206890, 5552408	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	16533288		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28521472		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27458161, 33302660	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32531826	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	LHGDN	12377969, 16502591		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	12515724, 22253704		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	12515724, 17852451	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	10753836, 11788931, 12239154, 12377969, 12515724, 12591276, 12730106, 12756017, 12893745, 14617008, 14617016, 14701686, 15034760, 15194544, 15327515, 15477215, 16197445, 16533288, 17256145, 17384217, 17852451, 17976520, 18324972, 18623127		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	10753836, 12239154, 17852451, 17976520	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	12377969, 12591276, 14701686		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	12515724, 12591276, 12893745, 14617008, 15238147, 16081684, 16197445, 17384217, 18324972, 18557746	Associate	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	12377969, 15327515, 15985544, 16197445, 16919893, 17852451, 22300941		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16161153		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	1692888		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	25522406	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	16081684, 17976520, 23206890	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16081684, 17976520, 31232862		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	22300941	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23899160		★☆☆☆☆ Found in Text Mining only
Thalassemia Minor	Thalassemia	BEFREE	18324972		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	12515724, 22300941	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	17852451, 17976520	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	10753836, 12377969, 12515724, 12756017, 14617016, 15034760, 15327515, 15461629, 15477215, 16197445, 16682284, 16919893, 17369568, 17384217, 17852451, 17976520, 18623127, 18802948, 22300941		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	12377969, 16502591		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Neonatal Alloimmune	Thrombocytopenia	Pubtator	16614528	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	LHGDN	12377969		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	12515724		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	12515724, 28984903	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40595898	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36352147	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	27102815, 38213873	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	27365530		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PROCR 2 shared pathwaysCell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation Related via 2 shared pathways including Cell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation. PF4V1 2 shared pathwaysCell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation Related via 2 shared pathways including Cell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation. THBD 2 shared pathwaysCell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation Related via 2 shared pathways including Cell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation. PF4 2 shared pathwaysCell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation Related via 2 shared pathways including Cell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation. PROC 2 shared pathwaysCell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation Related via 2 shared pathways including Cell surface interactions at the vascular wall, Common Pathway of Fibrin Clot Formation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PROCR	0	[]	2	["Cell surface interactions at the vascular wall","Common Pathway of Fibrin Clot Formation"]	0	[]
PF4V1	0	[]	2	["Cell surface interactions at the vascular wall","Common Pathway of Fibrin Clot Formation"]	0	[]
THBD	0	[]	2	["Cell surface interactions at the vascular wall","Common Pathway of Fibrin Clot Formation"]	0	[]
PF4	0	[]	2	["Cell surface interactions at the vascular wall","Common Pathway of Fibrin Clot Formation"]	0	[]
PROC	0	[]	2	["Cell surface interactions at the vascular wall","Common Pathway of Fibrin Clot Formation"]	0	[]

Diseases Linked via Similar Genes

Thrombosis Linked via 3 of 5 related genesTHBD, PF4, PROC Myocardial infarction Linked via 2 of 5 related genesPROCR, THBD Venous thromboembolism Linked via 2 of 5 related genesPROCR, PROC Asthma Linked via 2 of 5 related genesTHBD, PROC Ischemic stroke Linked via 2 of 5 related genesTHBD, PROC

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Thrombosis	3	["THBD","PF4","PROC"]
Myocardial infarction	2	["PROCR","THBD"]
Venous thromboembolism	2	["PROCR","PROC"]
Asthma	2	["THBD","PROC"]
Ischemic stroke	2	["THBD","PROC"]