Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	929
Gene name	CD14 molecule
Gene symbol	CD14
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q31.3
Summary	The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been id

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016817	hsa-miR-335-5p	Microarray	18185580

Show/Hide all (8)

Transcription factor	Regulation	Reference
KLF4	Activation	17762869
MEF2D	Activation	12213324
SP1	Activation	17203216
SP1	Unknown	11698458
SP2	Unknown	11698458
SP3	Unknown	11698458
VDR	Activation	16402404
WT1	Activation	9484784

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA
GO:0001530	Function	Lipopolysaccharide binding	IDA	12594207
GO:0001819	Process	Positive regulation of cytokine production	IBA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001847	Function	Opsonin receptor activity	TAS	2402637
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IDA	15294986
GO:0002237	Process	Response to molecule of bacterial origin	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IDA	15294986
GO:0005515	Function	Protein binding	IPI	16880211, 20860622, 22265692, 25965346
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	7537731
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9548256
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006909	Process	Phagocytosis	TAS	9548256
GO:0006915	Process	Apoptotic process	TAS	9548256
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	8798531
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	3385210
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0016019	Function	Peptidoglycan immune receptor activity	TAS	8798531
GO:0016020	Component	Membrane	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	15039339
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12594207
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	8612135
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	27986454
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IBA
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045121	Component	Membrane raft	IEA
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0046696	Component	Lipopolysaccharide receptor complex	IBA
GO:0046696	Component	Lipopolysaccharide receptor complex	IDA	11274165
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070891	Function	Lipoteichoic acid binding	IDA	12594207
GO:0071219	Process	Cellular response to molecule of bacterial origin	IDA	15039339
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	8612135
GO:0071223	Process	Cellular response to lipoteichoic acid	IDA	12594207
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0071727	Process	Cellular response to triacyl bacterial lipopeptide	IDA	16880211
GO:0098552	Component	Side of membrane	IEA
GO:0140104	Function	Molecular carrier activity	IDA	1698311

MIM	HGNC	e!Ensembl
158120	1628	ENSG00000170458

P08571

Protein name

Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]

Protein function

Coreceptor for bacterial lipopolysaccharide (PubMed:1698311, PubMed:23264655). In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopol

PDB

4GLP

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected on macrophages (at protein level) (PubMed:1698311). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. {ECO:0000269|PubMed:1698311, ECO:0000269|

Sequence

MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA

Sequence length

375

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, GOUTY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CD14-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECZEMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CD14 (CD14 molecule)