CCNA2 (cyclin A2)

Gene

• Entrez ID: 890
• Gene name: Cyclin A2
• Gene symbol: CCNA2
• Synonyms (NCBI Gene): CCN1, CCNA
• Chromosome: 4
• Chromosome location: 4q27
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. [provide

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000119	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT000119	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT004017	hsa-miR-146a-5p	Microarray, qRT-PCR, Western blot	19944095
MIRT003999	hsa-let-7b-5p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	18379589
MIRT016556	hsa-miR-193b-3p	Microarray	20304954
MIRT021865	hsa-miR-132-3p	Western blot;qRT-PCR	21329664
MIRT024968	hsa-miR-212-3p	Western blot;qRT-PCR	21329664
MIRT027829	hsa-miR-98-5p	Microarray	19088304
MIRT000119	hsa-miR-24-3p	Microarray	19748357
MIRT000119	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Other	19748357
MIRT048136	hsa-miR-197-3p	CLASH	23622248
MIRT053538	hsa-miR-10b-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23125021
MIRT438744	hsa-miR-27b-3p	Luciferase reporter assay	24974217
MIRT438744	hsa-miR-27b-3p	Luciferase reporter assay	24974217
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438744	hsa-miR-27b-3p	Luciferase reporter assay	24974217
MIRT438744	hsa-miR-27b-3p	Luciferase reporter assay	24974217
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT438259	hsa-miR-130b-3p	Luciferase reporter assay	24681352
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT479810	hsa-miR-575	PAR-CLIP	20371350
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT479819	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT479818	hsa-miR-3666	PAR-CLIP	20371350
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT479815	hsa-miR-4295	PAR-CLIP	20371350
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT479813	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT479810	hsa-miR-575	PAR-CLIP	20371350
MIRT479808	hsa-miR-1825	PAR-CLIP	20371350
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT479802	hsa-miR-548aw	PAR-CLIP	20371350
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT479819	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT479818	hsa-miR-3666	PAR-CLIP	20371350
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT479815	hsa-miR-4295	PAR-CLIP	20371350
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT479813	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT479810	hsa-miR-575	PAR-CLIP	20371350
MIRT479808	hsa-miR-1825	PAR-CLIP	20371350
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT479802	hsa-miR-548aw	PAR-CLIP	20371350
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT479819	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT479818	hsa-miR-3666	PAR-CLIP	21572407
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT479815	hsa-miR-4295	PAR-CLIP	21572407
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT479813	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	21572407
MIRT479810	hsa-miR-575	PAR-CLIP	21572407
MIRT479808	hsa-miR-1825	PAR-CLIP	21572407
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT479802	hsa-miR-548aw	PAR-CLIP	21572407
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT479819	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT479818	hsa-miR-3666	PAR-CLIP	21572407
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT479815	hsa-miR-4295	PAR-CLIP	21572407
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT479813	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	21572407
MIRT479810	hsa-miR-575	PAR-CLIP	21572407
MIRT479808	hsa-miR-1825	PAR-CLIP	21572407
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT479802	hsa-miR-548aw	PAR-CLIP	21572407
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	23446348
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	23446348
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	23446348
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT479810	hsa-miR-575	PAR-CLIP	23446348
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	23446348
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	23446348
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	23446348
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT479810	hsa-miR-575	PAR-CLIP	23446348
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	23592263
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT479819	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT479818	hsa-miR-3666	PAR-CLIP	23592263
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT479815	hsa-miR-4295	PAR-CLIP	23592263
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT479813	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	23592263
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT479810	hsa-miR-575	PAR-CLIP	23592263
MIRT479808	hsa-miR-1825	PAR-CLIP	23592263
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT479802	hsa-miR-548aw	PAR-CLIP	23592263
MIRT479821	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT479822	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT479821	hsa-miR-19a-3p	qRT-PCR	32165872
MIRT479824	hsa-miR-29c-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), RNA-seq, qRT-PCR, Flow cytometry	32154226
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT479810	hsa-miR-575	PAR-CLIP	20371350
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT479819	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT479818	hsa-miR-3666	PAR-CLIP	20371350
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT479815	hsa-miR-4295	PAR-CLIP	20371350
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT479813	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT479810	hsa-miR-575	PAR-CLIP	20371350
MIRT479808	hsa-miR-1825	PAR-CLIP	20371350
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT479802	hsa-miR-548aw	PAR-CLIP	20371350
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT479819	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT479818	hsa-miR-3666	PAR-CLIP	20371350
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT479815	hsa-miR-4295	PAR-CLIP	20371350
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT479813	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT479810	hsa-miR-575	PAR-CLIP	20371350
MIRT479808	hsa-miR-1825	PAR-CLIP	20371350
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT479802	hsa-miR-548aw	PAR-CLIP	20371350
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT479819	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT479818	hsa-miR-3666	PAR-CLIP	21572407
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT479815	hsa-miR-4295	PAR-CLIP	21572407
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT479813	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	21572407
MIRT479810	hsa-miR-575	PAR-CLIP	21572407
MIRT479808	hsa-miR-1825	PAR-CLIP	21572407
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT479802	hsa-miR-548aw	PAR-CLIP	21572407
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT479819	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT479818	hsa-miR-3666	PAR-CLIP	21572407
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT479815	hsa-miR-4295	PAR-CLIP	21572407
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT479813	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	21572407
MIRT479810	hsa-miR-575	PAR-CLIP	21572407
MIRT479808	hsa-miR-1825	PAR-CLIP	21572407
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT479802	hsa-miR-548aw	PAR-CLIP	21572407
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	23446348
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	23446348
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	23446348
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT479810	hsa-miR-575	PAR-CLIP	23446348
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	23446348
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	23446348
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	23446348
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT479810	hsa-miR-575	PAR-CLIP	23446348
MIRT479826	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT479825	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT479824	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT479823	hsa-miR-6835-3p	PAR-CLIP	23592263
MIRT479822	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT479821	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT479820	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT479819	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT479818	hsa-miR-3666	PAR-CLIP	23592263
MIRT438259	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT479817	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT479816	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT479815	hsa-miR-4295	PAR-CLIP	23592263
MIRT479814	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT479813	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT479812	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT479811	hsa-miR-548e-5p	PAR-CLIP	23592263
MIRT479809	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT479810	hsa-miR-575	PAR-CLIP	23592263
MIRT479808	hsa-miR-1825	PAR-CLIP	23592263
MIRT479807	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT479806	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT479805	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT479804	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT479803	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT479802	hsa-miR-548aw	PAR-CLIP	23592263
MIRT871172	hsa-miR-1182	CLIP-seq
MIRT871173	hsa-miR-1207-3p	CLIP-seq
MIRT871174	hsa-miR-1304	CLIP-seq
MIRT871175	hsa-miR-145	CLIP-seq
MIRT871176	hsa-miR-146a	CLIP-seq
MIRT871177	hsa-miR-146b-5p	CLIP-seq
MIRT871178	hsa-miR-200b	CLIP-seq
MIRT871179	hsa-miR-200c	CLIP-seq
MIRT871180	hsa-miR-2110	CLIP-seq
MIRT871181	hsa-miR-216b	CLIP-seq
MIRT871182	hsa-miR-218	CLIP-seq
MIRT871183	hsa-miR-2277-3p	CLIP-seq
MIRT871184	hsa-miR-2682	CLIP-seq
MIRT871185	hsa-miR-3119	CLIP-seq
MIRT871186	hsa-miR-3675-3p	CLIP-seq
MIRT871187	hsa-miR-3685	CLIP-seq
MIRT871188	hsa-miR-3714	CLIP-seq
MIRT871189	hsa-miR-374c	CLIP-seq
MIRT871190	hsa-miR-384	CLIP-seq
MIRT871191	hsa-miR-4251	CLIP-seq
MIRT871192	hsa-miR-4271	CLIP-seq
MIRT871193	hsa-miR-4282	CLIP-seq
MIRT871194	hsa-miR-429	CLIP-seq
MIRT871195	hsa-miR-4292	CLIP-seq
MIRT871196	hsa-miR-4303	CLIP-seq
MIRT871197	hsa-miR-432	CLIP-seq
MIRT871198	hsa-miR-4329	CLIP-seq
MIRT871199	hsa-miR-449c	CLIP-seq
MIRT871200	hsa-miR-4528	CLIP-seq
MIRT871201	hsa-miR-4642	CLIP-seq
MIRT871202	hsa-miR-4667-5p	CLIP-seq
MIRT871203	hsa-miR-4684-5p	CLIP-seq
MIRT871204	hsa-miR-4700-5p	CLIP-seq
MIRT871205	hsa-miR-4720-5p	CLIP-seq
MIRT871206	hsa-miR-4725-3p	CLIP-seq
MIRT871207	hsa-miR-4799-3p	CLIP-seq
MIRT871208	hsa-miR-495	CLIP-seq
MIRT871209	hsa-miR-5096	CLIP-seq
MIRT871210	hsa-miR-545	CLIP-seq
MIRT871211	hsa-miR-548aa	CLIP-seq
MIRT871212	hsa-miR-548an	CLIP-seq
MIRT871213	hsa-miR-550b	CLIP-seq
MIRT871214	hsa-miR-570	CLIP-seq
MIRT871215	hsa-miR-589	CLIP-seq
MIRT871216	hsa-miR-636	CLIP-seq
MIRT871217	hsa-miR-637	CLIP-seq
MIRT871218	hsa-miR-640	CLIP-seq
MIRT871219	hsa-miR-655	CLIP-seq
MIRT871178	hsa-miR-200b	CLIP-seq
MIRT871179	hsa-miR-200c	CLIP-seq
MIRT1958665	hsa-miR-219-5p	CLIP-seq
MIRT871184	hsa-miR-2682	CLIP-seq
MIRT1958666	hsa-miR-3064-3p	CLIP-seq
MIRT1958667	hsa-miR-326	CLIP-seq
MIRT1958668	hsa-miR-330-5p	CLIP-seq
MIRT871188	hsa-miR-3714	CLIP-seq
MIRT871193	hsa-miR-4282	CLIP-seq
MIRT871194	hsa-miR-429	CLIP-seq
MIRT1958669	hsa-miR-4445	CLIP-seq
MIRT871199	hsa-miR-449c	CLIP-seq
MIRT1958670	hsa-miR-4715-3p	CLIP-seq
MIRT1958671	hsa-miR-4742-3p	CLIP-seq
MIRT1958672	hsa-miR-4782-3p	CLIP-seq
MIRT1958673	hsa-miR-508-3p	CLIP-seq
MIRT871212	hsa-miR-548an	CLIP-seq
MIRT1958674	hsa-miR-630	CLIP-seq
MIRT871172	hsa-miR-1182	CLIP-seq
MIRT871173	hsa-miR-1207-3p	CLIP-seq
MIRT871174	hsa-miR-1304	CLIP-seq
MIRT871178	hsa-miR-200b	CLIP-seq
MIRT871179	hsa-miR-200c	CLIP-seq
MIRT871183	hsa-miR-2277-3p	CLIP-seq
MIRT2195421	hsa-miR-3660	CLIP-seq
MIRT871189	hsa-miR-374c	CLIP-seq
MIRT871194	hsa-miR-429	CLIP-seq
MIRT2195422	hsa-miR-4526	CLIP-seq
MIRT871200	hsa-miR-4528	CLIP-seq
MIRT871201	hsa-miR-4642	CLIP-seq
MIRT2195423	hsa-miR-4668-3p	CLIP-seq
MIRT871205	hsa-miR-4720-5p	CLIP-seq
MIRT2195424	hsa-miR-4795-3p	CLIP-seq
MIRT871207	hsa-miR-4799-3p	CLIP-seq
MIRT1958674	hsa-miR-630	CLIP-seq
MIRT871219	hsa-miR-655	CLIP-seq
MIRT2385705	hsa-miR-1323	CLIP-seq
MIRT2385706	hsa-miR-3143	CLIP-seq
MIRT2385707	hsa-miR-4803	CLIP-seq
MIRT2385708	hsa-miR-548o	CLIP-seq
MIRT871213	hsa-miR-550b	CLIP-seq
MIRT2385705	hsa-miR-1323	CLIP-seq
MIRT2498730	hsa-miR-3117-3p	CLIP-seq
MIRT2385706	hsa-miR-3143	CLIP-seq
MIRT2498731	hsa-miR-3163	CLIP-seq
MIRT2498732	hsa-miR-3200-3p	CLIP-seq
MIRT2498733	hsa-miR-340	CLIP-seq
MIRT871197	hsa-miR-432	CLIP-seq
MIRT2498734	hsa-miR-4677-3p	CLIP-seq
MIRT2498735	hsa-miR-4679	CLIP-seq
MIRT2498736	hsa-miR-4724-3p	CLIP-seq
MIRT2385707	hsa-miR-4803	CLIP-seq
MIRT2498737	hsa-miR-548c-3p	CLIP-seq
MIRT2385708	hsa-miR-548o	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREM	Repression	9280058
E2F3	Unknown	16909110
E4F1	Repression	15805267
E4F1	Unknown	14645522
ESR1	Activation	17681750
MYC	Unknown	7608142
NR4A1	Repression	12842839
RBL1	Repression	8642699
SOX6	Repression	21084391
SP1	Repression	18368381
TP53	Unknown	8270002
ZBTB16	Repression	20731660
ZBTB16	Unknown	14527952
ZHX2	Repression	22406477

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	1312467
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	1312467
GO:0000086	Process	G2/M transition of mitotic cell cycle	NAS	1312467
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	1312467
GO:0001939	Component	Female pronucleus	IEA
GO:0001940	Component	Male pronucleus	IEA
GO:0005515	Function	Protein binding	IPI	7630397, 8411358, 8684460, 8756328, 12244298, 12941338, 15189033, 15239650, 15890360, 16061792, 16209941, 16431923, 17254966, 18177895, 20596027, 21540187, 21952639, 22810586, 23455922, 23602568, 24358021, 24670654, 25852190, 26496610, 28514442, 30833792, 33961781, 34591612, 3527131
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	1312467, 16109376
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	8245034
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	1312467
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006275	Process	Regulation of DNA replication	IMP	17234884
GO:0006351	Process	DNA-templated transcription	IEA
GO:0007265	Process	Ras protein signal transduction	IEP	9054499
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IDA	1312467
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	1312467, 15024385
GO:0019904	Function	Protein domain specific binding	IPI	15024385
GO:0031100	Process	Animal organ regeneration	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0043687	Process	Post-translational protein modification	IDA	11746698
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0044843	Process	Cell cycle G1/S phase transition	IDA	1312467
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0051301	Process	Cell division	IEA
GO:0071314	Process	Cellular response to cocaine	IEA
GO:0071373	Process	Cellular response to luteinizing hormone stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071732	Process	Cellular response to nitric oxide	IEA
GO:0090102	Process	Cochlea development	IEA
GO:0097122	Component	Cyclin A2-CDK1 complex	IEA
GO:0097122	Component	Cyclin A2-CDK1 complex	NAS	1312467
GO:0097124	Component	Cyclin A2-CDK2 complex	IBA
GO:0097124	Component	Cyclin A2-CDK2 complex	IDA	1312467, 8684460, 11746698, 15024385
GO:0097124	Component	Cyclin A2-CDK2 complex	IEA
GO:0097124	Component	Cyclin A2-CDK2 complex	IPI	12244298
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

Other IDs

• MIM: 123835
• HGNC: 1578
• e!Ensembl: ENSG00000145386

Protein

• UniProt ID: P20248
• Protein name: Cyclin-A2 (Cyclin-A) (Cyclin A)
• Protein function: Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cy
• PDB: 1E9H, 1FIN, 1FVV, 1GY3, 1H1P, 1H1Q, 1H1R, 1H1S, 1H24, 1H25, 1H26, 1H27, 1H28, 1JST, 1JSU, 1OGU, 1OI9, 1OIU, 1OIY, 1OKV, 1OKW, 1OL1, 1OL2, 1P5E, 1PKD, 1QMZ, 1URC, 1VYW, 2BKZ, 2BPM, 2C4G, 2C5N, 2C5O, 2C5V, 2C5X, 2C6T, 2CCH, 2CCI, 2CJM, 2I40, 2IW6, 2IW8, 2IW9, 2UUE, 2UZB, 2UZD, 2UZE, 2UZL, 2V22, 2WEV, 2WFY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16500	Cyclin_N2	28 → 166	N-terminal region of cyclin_N	Family
  PF00134	Cyclin_N	181 → 307	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	309 → 427	Cyclin, C-terminal domain	Domain

• Sequence:

  MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
  LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
  EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE
  DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
  RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
  VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
  HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
  VSLLNPPETLNL

• Sequence length: 432

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
INTELLECTUAL DISABILITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	8656699		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10023668		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17255290		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22232705		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29805671		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32147961, 37535572, 38053725	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10656729	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	35782055	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	25135600		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	17255290		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17255290, 27893678	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37335738	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29375713, 30138038		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21320484, 23125021, 26397737, 27183383, 28454465, 30675923		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10934345, 11875707, 12429812, 12627500, 12719458, 15187102, 16670718, 16823179, 17201163, 19706846, 22918167, 23446853, 24207091, 24622579, 25220500, 26621841, 26691213, 31285741, 31446607, 33128008, 33285689, 33499770, 34172056, 35447458	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	22918167	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14681231, 24207091, 24519066, 35782055	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24485923	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	12073048, 24519066, 29633253	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10209305, 10884382, 12612447, 14606074, 15298730, 21625435, 26867494, 29728556, 29843214, 30272310, 30531861, 31043166, 31375600, 31746405, 32046048, 32722976, 34087888, 34257537, 34445994, 34696748, 34743578, 35720901, 36120772, 36133439, 36317111, 36479313	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29375713, 30138038		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34794761	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29483831, 30765611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10471053, 28260099, 30358218, 32626756, 32712616, 35401923	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29135120	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10491016, 15902736, 16832409, 32340320, 37442189, 9484827	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19567385	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	29633253		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31362365		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31362365		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12125919	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12198252		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29345391		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15858123, 36181111	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30464611		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12930830, 15385053, 24023782, 25596928, 29082250, 33744866, 34754259, 35774271, 36123948, 36183698, 37324189, 40018943, 8576279	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31315286	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	17566113	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	31315286	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19583808, 31289358		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	12073048	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10491016, 12073048, 24519066, 31289358, 33503056, 35682908, 36454788, 37853361, 38646803	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	26537625	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15902736, 34232175, 35484963, 40598454	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15902736, 30766610, 31485619, 34232175, 40598454	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21157974	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	17384652, 29513793	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	LHGDN	17359356		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	14726653	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22718829		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22718829		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11305412, 27613831, 30995921, 35774141, 35903107	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	10879738, 15100731	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	10883664	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	12612447		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	12612447	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	12073048	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	16445666	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	16941028	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14710850, 22116304, 29426911	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	39351249	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19363140		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	19363140	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34994159	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	21937992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	37310408	Stimulate	★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	16832409	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	10854234	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25748237	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12417757, 15935816, 19668232		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12417757	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19444595, 9627219	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24965603	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12601350		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1967822, 27738335, 29843214, 30531861		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25596928	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	8530809		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18676680, 32831194, 9393586, 9736045	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	LHGDN	17359356		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21320484, 21858804, 23125021, 26397737, 27183383, 28454465, 30675923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31289358		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	8530809		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21858804		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27035224		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21900400		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30349301, 31135068		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29375713, 30138038		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14510182, 16760651, 19583808, 23979921, 26685215, 28501767		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31362365		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25596928, 29345391		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12444551, 16670718, 16823179		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16823179		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	32961817	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	29984917	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10727462, 22763964	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12204057	Associate	★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	37369845	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31087423		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24732040	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35509856	Associate	★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	10471053	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11212263, 27738335, 29344992, 30766610, 9815824		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11212263		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30679313, 31278532		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32537647	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22312289, 23042265, 32377701, 32886452, 34253236	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34794761	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	20574166		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27035224		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25577248, 27035224, 34171978, 39351249	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33020506	Stimulate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	35835355	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31497245		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18668132		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21900400		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16762917, 24079846, 27029529, 34198380, 34497666, 35303200, 35305591, 36834602	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	24303025, 33416099	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	11719516	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	16899113	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	10576659	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	17608974		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases	Skin disease	Pubtator	22763964	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	33186389, 34825846	Stimulate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	37062286, 9393586	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30766610		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10883664, 19596857, 26409447, 26912061, 29785357, 30249886, 32228488, 37452322	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	29464035		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30349301, 31135068		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20525401	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16708383		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20525401, 21777278, 26211905, 30106448, 34126961, 37904473	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26706989	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30213925, 31183379, 33025856	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19706846, 24622579, 34366326, 35627287	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	23259573	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25136960, 37740761, 38273747, 39456780, 40598454	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33217824	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16538218, 26041102, 29989647, 31362365, 35246013	Associate	★☆☆☆☆ Found in Text Mining only