CCN5 (cellular communication network factor 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 8839
Gene name Cellular communication network factor 5
Gene symbol CCN5
Synonyms (NCBI Gene)
CT58CTGF-LWISP2
Chromosome 20
Chromosome location 20q13.12
Summary This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005178 Function Integrin binding IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IDA 10358067, 23359679
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
603399 12770 ENSG00000064205
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O76076
Protein name CCN family member 5 (Connective tissue growth factor-like protein) (CTGF-L) (Connective tissue growth factor-related protein 58) (WNT1-inducible-signaling pathway protein 2) (WISP-2)
Protein function May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00093 VWC 100 → 163 von Willebrand factor type C domain Family
PF00219 IGFBP 26 → 78 Insulin-like growth factor binding protein Domain
PF19035 TSP1_CCN 194 → 237 CCN3 Nov like TSP1 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.
Sequence 
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRL
GEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQ
FSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPS
RGRSPQNSAF
Sequence length 250
Interactions View interactions

No strongly related genes found yet for CCN5.

No additional diseases found yet through genes similar to CCN5.