CCL1 (C-C motif chemokine ligand 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 6346
Gene name C-C motif chemokine ligand 1
Gene symbol CCL1
Synonyms (NCBI Gene)
I-309P500SCYA1SISeTCA3
Chromosome 17
Chromosome location 17q12
Summary This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies
miRNA miRNA information provided by mirtarbase database.
14 Show/Hide all (14)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT000257 hsa-miR-17-5p Luciferase reporter assay 19734348
MIRT440987 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT440986 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT440985 hsa-miR-21-5p HITS-CLIP 22473208
MIRT440987 hsa-miR-106b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29 Show/Hide all (29)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IDA 1557400
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
182281 10609 ENSG00000108702
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P22362
Protein name C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)
Protein function Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
PDB 1EL0 , 4OIJ , 4OIK , 8U1U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 31 → 88 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence 
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Sequence length 96
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Cytokine-cytokine receptor interaction Chemokine receptors bind chemokines
Viral protein interaction with cytokine and cytokine receptor G alpha (i) signalling events
Chemokine signaling pathway  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (7)
Phenotype Name Clinical Significance Source Reference Evidence Score
CHRONIC OBSTRUCTIVE AIRWAY DISEASE — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE — GWAS catalog 40155373
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER — GWAS catalog 37359372
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS — CTD, Disgenet
CTD, Disgenet 		30579999
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS — CTD, Disgenet
CTD, Disgenet 		10385480
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (75)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 27524264
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 27524264
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of pancreas Pancreatic adenocarcinoma BEFREE 17352218
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 11493464
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 27229914 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 31121182
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 15944327
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma LHGDN 16540498
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 18684970 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 19152963 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
CXCL13 5 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, G alpha (i) signalling events, Chemokine receptors bind chemokines 2 shared evidence sourcesCTD (Endometriosis), Disgenet (Endometriosis) Related via 5 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor — evidence mostly CTD. CXCR3 1 shared diseaseGlomerulonephritis 5 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, G alpha (i) signalling events, Chemokine receptors bind chemokines 2 shared evidence sourcesDisgenet (Glomerulonephritis), CTD (Glomerulonephritis) Related via 5 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor — evidence mostly Disgenet. CCL7 1 shared diseaseGlomerulonephritis 4 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Chemokine receptors bind chemokines 3 shared evidence sourcesDisgenet (Glomerulonephritis), CTD (Glomerulonephritis), Disgenet (Multiple sclerosis) Related via 4 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor — evidence mostly Disgenet. SCGB1A1 2 shared diseasesObstructive airway disease, Glomerulonephritis 2 shared evidence sourcesDisgenet (Obstructive airway disease), Disgenet (Glomerulonephritis) Related via 2 shared diseases including Obstructive airway disease, Glomerulonephritis — evidence mostly Disgenet. CCL27 5 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, G alpha (i) signalling events, Chemokine receptors bind chemokines Related via 5 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor.
Mesothelioma Linked via 3 of 5 related genesCXCL13, CCL7, CCL27 Asthma Linked via 2 of 5 related genesCXCR3, SCGB1A1 Contact dermatitis Linked via 2 of 5 related genesCXCR3, CCL27 Hypersensitivity Linked via 2 of 5 related genesCXCR3, CCL7 Rheumatoid arthritis Linked via 1 of 5 related genesCXCL13