CCDC74B (coiled-coil domain containing 74B)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 91409
Gene name Coiled-coil domain containing 74B
Gene symbol CCDC74B
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2q21.1
miRNA miRNA information provided by mirtarbase database.
24 Show/Hide all (24)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT039462 hsa-miR-652-3p CLASH 23622248
MIRT442996 hsa-miR-4495 PAR-CLIP 22100165
MIRT442995 hsa-miR-379-3p PAR-CLIP 22100165
MIRT442994 hsa-miR-411-3p PAR-CLIP 22100165
MIRT442993 hsa-miR-380-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LY2
Protein name Coiled-coil domain-containing protein 74B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14916 CCDC92 47 → 102 Coiled-coil domain of unknown function Coiled-coil
PF14917 CCDC74_C 263 → 377 Coiled coil protein 74, C terminal Coiled-coil
Sequence 
MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFL
QQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDGPSGNHLSRASAPLGARWVCI
NGVWVEPGGPSPARLKEGSSRTHRPGGKHGRLAGGSADTVRSPADSLSTSSFQSVKSISN
SGKARPQPGSFNKQDSKADVPQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAA
CMGNSQHQGRQMGAAAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELQHLKSLL
EGSQRPQAVPEEASFPRDQEATHFPKVSTKSLSKKCLLLSPPVAERAILPALKQTPKNNF
AERQKRLQAMQKRRLHRSVL
Sequence length 380
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Malignant tumor of urinary bladder Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Pulmonary Disease Chronic Obstructive Chronic obstructive pulmonary disease Pubtator 36194576 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for CCDC74B.

No additional diseases found yet through genes similar to CCDC74B.