CCDC54 (coiled-coil domain containing 54)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 84692 |
| Gene name | Coiled-coil domain containing 54 |
| Gene symbol | CCDC54 |
| Synonyms (NCBI Gene) |
NYD-SP17SP17
|
| Chromosome | 3 |
| Chromosome location | 3q13.12 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8NEL0 |
| Protein name | Coiled-coil domain-containing protein 54 (Testis development protein NYD-SP17) |
| Family and domains | |
| Sequence |
MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTSDDCNQDDDSY |
| Sequence length | 328 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with CCDC54 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to CCDC54 (see Related Genes above), that are NOT already directly curated for CCDC54 itself -- a lead worth checking, not a confirmed association.
0
|
|