Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	83643
Gene name	Coiled-coil domain containing 3
Gene symbol	CCDC3
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10p13

30 Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022206	hsa-miR-124-3p	Microarray	18668037
MIRT868812	hsa-miR-138	CLIP-seq
MIRT868813	hsa-miR-1972	CLIP-seq
MIRT868814	hsa-miR-3179	CLIP-seq
MIRT868815	hsa-miR-3202	CLIP-seq
MIRT868816	hsa-miR-3674	CLIP-seq
MIRT868817	hsa-miR-3978	CLIP-seq
MIRT868818	hsa-miR-4274	CLIP-seq
MIRT868819	hsa-miR-4476	CLIP-seq
MIRT868820	hsa-miR-4688	CLIP-seq
MIRT868821	hsa-miR-4694-5p	CLIP-seq
MIRT868822	hsa-miR-4768-5p	CLIP-seq
MIRT868823	hsa-miR-486-3p	CLIP-seq
MIRT868824	hsa-miR-622	CLIP-seq
MIRT868825	hsa-miR-651	CLIP-seq
MIRT868826	hsa-miR-885-3p	CLIP-seq
MIRT1957807	hsa-miR-1207-3p	CLIP-seq
MIRT1957808	hsa-miR-1236	CLIP-seq
MIRT1957809	hsa-miR-198	CLIP-seq
MIRT1957810	hsa-miR-2278	CLIP-seq
MIRT1957811	hsa-miR-3182	CLIP-seq
MIRT1957812	hsa-miR-3649	CLIP-seq
MIRT1957813	hsa-miR-455-3p	CLIP-seq
MIRT1957814	hsa-miR-520a-5p	CLIP-seq
MIRT1957815	hsa-miR-525-5p	CLIP-seq
MIRT1957816	hsa-miR-711	CLIP-seq
MIRT1957817	hsa-miR-888	CLIP-seq
MIRT2194843	hsa-miR-33a	CLIP-seq
MIRT2194844	hsa-miR-33b	CLIP-seq
MIRT2385638	hsa-miR-34b	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	28827783
GO:0005576	Component	Extracellular region	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0007165	Process	Signal transduction	IDA	28827783
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0010629	Process	Negative regulation of gene expression	IBA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	25193116
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045833	Process	Negative regulation of lipid metabolic process	IDA	28827783
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	IEA

MIM	HGNC	e!Ensembl
620579	23813	ENSG00000151468

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9BQI4
Protein name	Coiled-coil domain-containing protein 3 (Fat/vessel-derived secretory protein) (Favine)
Protein function	Negatively regulates TNF-alpha-induced pro-inflammatory response in endothelial cells (ECs) via inhibition of TNF-alpha-induced NF-kappaB activation in ECs (PubMed:25193116). Positively regulates lipid accumulation in adipose cells (By similarit
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in umbilical vein endothelial cells (HUVEC), and at lower levels in aortic smooth muscle cells (HASMC). {ECO:0000269\|PubMed:20043878}.
Sequence	MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYN HLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSY FFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQE DSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLEL ANQKLSEKLAAGALPHINARGPVRPPYLRG
Sequence length	270
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	32595297	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and oral cavity carcinoma	association not found	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Breast Neoplasms	Breast neoplasm	Pubtator	36647876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31081073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31081073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33568476	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31081073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31081073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with CCDC3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CCDC3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CCDC3 (see Related Genes above), that are NOT already directly curated for CCDC3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CCDC3.

CCDC3 (coiled-coil domain containing 3)

Bookmark This Gene