CCDC200 (coiled-coil domain containing 200)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100874261 |
| Gene name | Coiled-coil domain containing 200 |
| Gene symbol | CCDC200 |
| Synonyms (NCBI Gene) |
LINC00854TMEM106A-AS1
|
| Chromosome | 17 |
| Chromosome location | 17q21.31 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A1B0GVQ3 |
| Protein name | Coiled-coil domain-containing protein 200 |
| Family and domains | |
| Sequence |
MGSAYHWEARRRQMALDRRRWLMAQQQQELQQKEQELKNHQEEEQQSEEKLQPHKKLNVP |
| Sequence length | 168 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with CCDC200 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to CCDC200 (see Related Genes above), that are NOT already directly curated for CCDC200 itself -- a lead worth checking, not a confirmed association.
0
|
|