CCDC184 (coiled-coil domain containing 184)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387856
Gene name Coiled-coil domain containing 184
Gene symbol CCDC184
Synonyms (NCBI Gene)
C12orf68
Chromosome 12
Chromosome location 12q13.11
miRNA miRNA information provided by mirtarbase database.
15 Show/Hide all (15)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT741659 hsa-miR-6507-3p HITS-CLIP 23824327
MIRT741660 hsa-miR-500a-5p HITS-CLIP 23824327
MIRT741661 hsa-miR-6865-3p HITS-CLIP 23824327
MIRT741662 hsa-miR-3620-3p HITS-CLIP 23824327
MIRT741663 hsa-miR-186-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q52MB2
Protein name Coiled-coil domain-containing protein 184
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15726 DUF4677 1 → 193 Domain of unknown function (DUF4677) Family
Sequence 
MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRA
MRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQSDPQEPET
PSPGIGDSGLLGRDPEDEEEEEEEKEMPSPATPSSHCERPESPCAGLLGGDGPLVEPLDM
PDITLLQLEGEASL
Sequence length 194
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
MIGRAINE DISORDER — GWAS catalog 36292730
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS — GWAS catalog 36292730
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for CCDC184.

No additional diseases found yet through genes similar to CCDC184.