CCDC159 (coiled-coil domain containing 159)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 126075
Gene name Coiled-coil domain containing 159
Gene symbol CCDC159
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0007283 Process Spermatogenesis IEA
GO:0007283 Process Spermatogenesis IEA
GO:0007286 Process Spermatid development IEA
GO:0007286 Process Spermatid development ISS
GO:0007338 Process Single fertilization IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C7I6
Protein name Coiled-coil domain-containing protein 159
Protein function Functions during spermatid development; may participate in the centrosome reduction procedure of spermatids and is required for the formation of the connecting piece/sperm head-tail coupling apparatus (HTCA) and the correct and tight attachment
Family and domains
Sequence 
MGEHEQVKPLETSSSKVKAKTIVMIPDSQKLLRCELESLKSQLQAQTKAFEFLNHSVTML
EKESCLQQIKIQQLEEVLSPTGRQGEKEEHKWGMEQGRQELYGALTQGLQGLEKTLRDSE
EMQRARTTRCLQLLAQEIRDSKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNIQKM
QKTQVKCRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVLQNSI
DSLTLCSGACPKASSLRGHKGHQCLSPPLPSWDSDSDCDQDLSQPPFSKSGRSFPPA
Sequence length 297
Interactions View interactions

No strongly related genes found yet for CCDC159.

No additional diseases found yet through genes similar to CCDC159.