Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	151278
Gene name	CCDC140 long non-coding RNA
Gene symbol	CCDC140
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q36.1
Summary	This gene encodes a protein that appears to be restricted to select higher primate species. This protein contains a C-terminal coiled-coil domain, which is a versatile structural motif consisting of multiple amphipathic alpha-helices that twist around eac

38 Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT648550	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT531094	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT531093	hsa-miR-5695	PAR-CLIP	22012620
MIRT531092	hsa-miR-378j	PAR-CLIP	22012620
MIRT531091	hsa-miR-6839-5p	PAR-CLIP	22012620
MIRT531090	hsa-miR-103a-2-5p	PAR-CLIP	22012620
MIRT531089	hsa-miR-152-5p	PAR-CLIP	22012620
MIRT531088	hsa-miR-515-5p	PAR-CLIP	22012620
MIRT531087	hsa-miR-519e-5p	PAR-CLIP	22012620
MIRT531086	hsa-miR-1299	PAR-CLIP	22012620
MIRT531085	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT531084	hsa-miR-4782-5p	PAR-CLIP	22012620
MIRT531083	hsa-miR-5706	PAR-CLIP	22012620
MIRT648550	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT531094	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT531093	hsa-miR-5695	PAR-CLIP	22012620
MIRT531092	hsa-miR-378j	PAR-CLIP	22012620
MIRT531091	hsa-miR-6839-5p	PAR-CLIP	22012620
MIRT531090	hsa-miR-103a-2-5p	PAR-CLIP	22012620
MIRT531089	hsa-miR-152-5p	PAR-CLIP	22012620
MIRT531088	hsa-miR-515-5p	PAR-CLIP	22012620
MIRT531087	hsa-miR-519e-5p	PAR-CLIP	22012620
MIRT531086	hsa-miR-1299	PAR-CLIP	22012620
MIRT531085	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT531084	hsa-miR-4782-5p	PAR-CLIP	22012620
MIRT531083	hsa-miR-5706	PAR-CLIP	22012620
MIRT2194703	hsa-miR-1262	CLIP-seq
MIRT2194704	hsa-miR-143	CLIP-seq
MIRT2194705	hsa-miR-4701-3p	CLIP-seq
MIRT2194706	hsa-miR-4770	CLIP-seq
MIRT2194707	hsa-miR-578	CLIP-seq
MIRT2194708	hsa-miR-635	CLIP-seq
MIRT2446381	hsa-miR-3125	CLIP-seq
MIRT2446382	hsa-miR-3916	CLIP-seq
MIRT2446383	hsa-miR-4455	CLIP-seq
MIRT2446384	hsa-miR-4506	CLIP-seq
MIRT2446385	hsa-miR-583	CLIP-seq
MIRT2446386	hsa-miR-609	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q96MF4

Protein name

Coiled-coil domain-containing protein 140

Family and domains

Sequence

MGDECSNPDLLAEPGSSPPWDHGNQRQEAANESNTRVPRVLKAHLGPETAQPTKRSKRNR
WRRQSCQGPSPARSGQFLGSADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRA
ARPRTRTLPTPHSFKIGEEAEEMKKKKERKRRKERKKERNFKK

Sequence length

163

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes Genes most often co-reported with CCDC140 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CCDC140.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CCDC140 (see Related Genes above), that are NOT already directly curated for CCDC140 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CCDC140.

CCDC140 (CCDC140 long non-coding RNA)

Save This Analysis