CBLL2 (Cbl proto-oncogene like 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 158506
Gene name Cbl proto-oncogene like 2
Gene symbol CBLL2
Synonyms (NCBI Gene)
CT138HAKAILZNF645
Chromosome X
Chromosome location Xp22.11
Summary This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0008270 Function Zinc ion binding IEA
GO:0016567 Process Protein ubiquitination IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N7E2
Protein name E3 ubiquitin-protein ligase CBLL2 (EC 2.3.2.27) (Cbl proto-oncogene-like protein 2) (RING-type E3 ubiquitin transferase ZNF645) (Zinc finger protein 645) (c-Cbl-like protein 2)
Protein function E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed:20657603). May operate on tyrosine-phosphorylated SRC substrates (PubMed:22252131). {ECO:0000269|PubMed:20657603, ECO:0000269|PubMed:222
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18408 zf_Hakai 109 → 140 C2H2 Hakai zinc finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Exclusively expressed in testis and sperm, including spermatocytes, round and elongated spermatids, and Leydig cells. {ECO:0000269|PubMed:20657603}.
Sequence 
MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKDDLPIHFCDKC
DLPIKIYGRIIPCKHAFCYHCANLYDKVGYKVCPRCRYPVLRIEAHKRGSVFMCSIVQQC
KRTYLSQKSLQAHIKRRHKRARKQVTSASLEKVRPHIAPPQTEISDIPKRLQDRDHLSYI
PPEQHTMVSLPSVQHMLQEQHNQPHKDIQAPPPELSLSLPFPIQWETVSIFTRKHGNLTV
DHIQNNSDSGAKKPTPPDYYPECQSQPAVSSPHHIIPQKQHYAPPPSPSSPVNHQMPYPP
QDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNPSASEFASHHY
NLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQR
RHRRY
Sequence length 425
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Antigen processing: Ubiquitination & Proteasome degradation

No strongly related genes found yet for CBLL2.

No additional diseases found yet through genes similar to CBLL2.