CATSPERZ (catsper channel auxiliary subunit zeta)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 25858
Gene name Catsper channel auxiliary subunit zeta
Gene symbol CATSPERZ
Synonyms (NCBI Gene)
C11orf20TEX40
Chromosome 11
Chromosome location 11q13.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21 Show/Hide all (21)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IDA
GO:0005886 Component Plasma membrane IEA
GO:0005929 Component Cilium IEA
GO:0007140 Process Male meiotic nuclear division ISS
GO:0007283 Process Spermatogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617511 19231 ENSG00000219435
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NTU4
Protein name Cation channel sperm-associated auxiliary subunit zeta (CatSper-zeta) (CatSperzeta) (Testis-expressed protein 40)
Protein function Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation. Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization. Required for a distribut
Family and domains
Sequence 
MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNIS
KTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKS
SSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTK
ELQRYIEGLKKRRSKRLYVN
Sequence length 200
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 40883957
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (6)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 21949640
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of ovary Ovarian cancer BEFREE 21949640, 24504521
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 21949640
★★★★★
★☆☆☆☆
Found in Text Mining only
Ovarian Carcinoma Ovarian Carcinoma BEFREE 21949640
★★★★★
★☆☆☆☆
Found in Text Mining only
Ovarian Diseases Ovarian diseases Pubtator 24504521 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 21949640, 24504521 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for CATSPERZ.

No additional diseases found yet through genes similar to CATSPERZ.