CATSPERH (catsper channel auxiliary subunit eta)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100130348
Gene name Catsper channel auxiliary subunit eta
Gene symbol CATSPERH
Synonyms (NCBI Gene)
TMEM262
Chromosome 11
Chromosome location 11q13.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005929 Component Cilium IEA
GO:0016020 Component Membrane IEA
GO:0031514 Component Motile cilium IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
E9PQX1
Protein name Cation channel sperm-associated auxiliary subunit TMEM262 (Cation channel sperm-associated auxiliary subunit eta) (Transmembrane protein 262)
Protein function Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation.
Family and domains
Sequence 
MWLQDRIATFFFPKGMMLTTAALMLFFLHLGIFIRDVHNFCITYHYDHMSFHYTVVLMFS
QVISICWAAMGSLYAEMTENKYVCFSALTILMLNGAMFFNRLSLEFLAIEYREEHH
Sequence length 116
Interactions View interactions

No strongly related genes found yet for CATSPERH.

No additional diseases found yet through genes similar to CATSPERH.