CASP5 (caspase 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 838
Gene name Caspase 5
Gene symbol CASP5
Synonyms (NCBI Gene)
ICE(rel)IIIICEREL-IIIICH-3
Chromosome 11
Chromosome location 11q22.3
Summary This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing
miRNA miRNA information provided by mirtarbase database.
16 Show/Hide all (16)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT443068 hsa-miR-143-3p PAR-CLIP 22100165
MIRT443067 hsa-miR-4770 PAR-CLIP 22100165
MIRT443065 hsa-miR-6088 PAR-CLIP 22100165
MIRT443066 hsa-miR-1909-5p PAR-CLIP 22100165
MIRT443064 hsa-miR-4480 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25 Show/Hide all (25)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004197 Function Cysteine-type endopeptidase activity IDA 16920334, 37993714
GO:0004197 Function Cysteine-type endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 30692621
GO:0005737 Component Cytoplasm IBA
GO:0005829 Component Cytosol IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602665 1506 ENSG00000137757
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P51878
Protein name Caspase-5 (CASP-5) (EC 3.4.22.58) (ICE(rel)-III) (Protease ICH-3) (Protease TY) [Cleaved into: Caspase-5 subunit p20; Caspase-5 subunit p10]
Protein function Thiol protease that acts as a mediator of programmed cell death (PubMed:28314590, PubMed:29898893). Initiates pyroptosis, a programmed lytic cell death pathway through cleavage of Gasdermin-D (GSDMD): cleavage releases the N-terminal gasdermin m
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00619 CARD 61 → 146 Caspase recruitment domain Domain
PF00656 Peptidase_C14 193 → 430 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in barely detectable amounts in most tissues except brain, highest levels being found in lung, liver and skeletal muscle. {ECO:0000269|PubMed:7797592}.
Sequence 
MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVK
KDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLR
KNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHD
EIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARD
MESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYDTIFQIFNNRNC
LSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFIAF
CSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIE
RATLTRDFYLFPGN
Sequence length 434
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
NOD-like receptor signaling pathway
Salmonella infection
Sort by:
GSDMD 2 shared pathwaysNOD-like receptor signaling pathway, Salmonella infection Related via 2 shared pathways including NOD-like receptor signaling pathway, Salmonella infection. NAIP 2 shared pathwaysNOD-like receptor signaling pathway, Salmonella infection Related via 2 shared pathways including NOD-like receptor signaling pathway, Salmonella infection. PKN1 2 shared pathwaysNOD-like receptor signaling pathway, Salmonella infection Related via 2 shared pathways including NOD-like receptor signaling pathway, Salmonella infection. TXN2 2 shared pathwaysNOD-like receptor signaling pathway, Salmonella infection Related via 2 shared pathways including NOD-like receptor signaling pathway, Salmonella infection. CASP4 2 shared pathwaysNOD-like receptor signaling pathway, Salmonella infection Related via 2 shared pathways including NOD-like receptor signaling pathway, Salmonella infection.
Insomnia Linked via 1 of 5 related genesGSDMD Proximal spinal muscular atrophy Linked via 1 of 5 related genesNAIP Spinal muscular atrophy Linked via 1 of 5 related genesNAIP Pancreatic cancer Linked via 1 of 5 related genesPKN1 Ureterolithiasis Linked via 1 of 5 related genesPKN1