CASC2 (cancer susceptibility 2) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	255082
Gene name	Cancer susceptibility 2
Gene symbol	CASC2
Synonyms (NCBI Gene)	C10orf5
Chromosome	10
Chromosome location	10q26.11

4

miRTarBase ID	miRNA	Experiments	Reference
MIRT731121	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayImmunoprecipitaionWestern blot	25446261
MIRT731121	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayImmunoprecipitaionWestern blot	25446261
MIRT734504	hsa-miR-152-3p	ELISAFlow cytometryImmunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	34165388
MIRT735165	hsa-miR-27b-5p	Luciferase reporter assayWestern blottingqRT-PCRELISA	33174006

MIM	HGNC	e!Ensembl
608598	22933	ENSG00000177640

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q6XLA1
Protein name	Protein CASC2, isoform 3 (Cancer susceptibility candidate gene 2 protein, isoform 3)
Protein function	May act as a potential tumor suppressor.
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in normal and neoplastic endometrial tissues. {ECO:0000269\|PubMed:15024726}.
Sequence	MTQEKMYPHLFSERCANQHQHRTAEEKKYVSEKQLIHWRCEEPSAHHNSIDIKRMKHFGS ALRLRQTFHLDTADHPCVITMNPALPWKLEGSNSTSTLPLPA
Sequence length	102
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8IU53
Protein name	Protein CASC2, isoforms 1/2 (Cancer susceptibility candidate gene 2 protein isoforms 1/2)
Family and domains
Sequence	MAGTRGLMLLGPGPVAGPRDVGTCRGRQMEIQKHKDNKKLPQGIIIVFRLQTHTTPQIYT QLKGKLRKFFKEPYSE
Sequence length	76
Interactions	View interactions