CARD17P (caspase recruitment domain family member 17, pseudogene)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 440068
• Gene name: Caspase recruitment domain family member 17, pseudogene
• Gene symbol: CARD17P
• Synonyms (NCBI Gene): CARD17, INCA
• Chromosome: 11
• Chromosome location: 11q22.3

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	15383541, 27043298
GO:0005737	Component	Cytoplasm	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IDA	15383541
GO:0032991	Component	Protein-containing complex	IDA	15383541
GO:0032991	Component	Protein-containing complex	IEA
GO:0042802	Function	Identical protein binding	IDA	15383541
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	15383541
GO:0089720	Function	Caspase binding	IPI	15383541

Other IDs

• MIM: 609490
• HGNC: 33827
• e!Ensembl: HGNC

Protein

• UniProt ID: Q5XLA6
• Protein name: Putative caspase recruitment domain-containing protein 17P (Caspase-1 inhibitor INCA) (Inhibitory caspase recruitment domain protein)
• Protein function: Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00619	CARD	3 → 90	Caspase recruitment domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15383541}.
• Sequence:

  MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDS
  VIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS

• Sequence length: 110

Related Genes

No strongly related genes found yet for CARD17P.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CARD17P.