CADM4 (cell adhesion molecule 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 199731
• Gene name: Cell adhesion molecule 4
• Gene symbol: CADM4
• Synonyms (NCBI Gene): IGSF4C, NECL4, Necl-4, TSLL2, synCAM4
• Chromosome: 19
• Chromosome location: 19q13.31

miRNA Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT858654	hsa-miR-1246	CLIP-seq
MIRT858655	hsa-miR-1254	CLIP-seq
MIRT858656	hsa-miR-1273f	CLIP-seq
MIRT858657	hsa-miR-185	CLIP-seq
MIRT858658	hsa-miR-2110	CLIP-seq
MIRT858659	hsa-miR-2861	CLIP-seq
MIRT858660	hsa-miR-3116	CLIP-seq
MIRT858661	hsa-miR-3138	CLIP-seq
MIRT858662	hsa-miR-3150b-3p	CLIP-seq
MIRT858663	hsa-miR-3179	CLIP-seq
MIRT858664	hsa-miR-3202	CLIP-seq
MIRT858665	hsa-miR-3622b-5p	CLIP-seq
MIRT858666	hsa-miR-3652	CLIP-seq
MIRT858667	hsa-miR-3914	CLIP-seq
MIRT858668	hsa-miR-4254	CLIP-seq
MIRT858669	hsa-miR-4271	CLIP-seq
MIRT858670	hsa-miR-4306	CLIP-seq
MIRT858671	hsa-miR-4430	CLIP-seq
MIRT858672	hsa-miR-4450	CLIP-seq
MIRT858673	hsa-miR-4493	CLIP-seq
MIRT858674	hsa-miR-4505	CLIP-seq
MIRT858675	hsa-miR-4520a-3p	CLIP-seq
MIRT858676	hsa-miR-4525	CLIP-seq
MIRT858677	hsa-miR-4644	CLIP-seq
MIRT858678	hsa-miR-4667-5p	CLIP-seq
MIRT858679	hsa-miR-4680-5p	CLIP-seq
MIRT858680	hsa-miR-4700-5p	CLIP-seq
MIRT858681	hsa-miR-4716-3p	CLIP-seq
MIRT858682	hsa-miR-4720-5p	CLIP-seq
MIRT858683	hsa-miR-4725-3p	CLIP-seq
MIRT858684	hsa-miR-4747-5p	CLIP-seq
MIRT858685	hsa-miR-4784	CLIP-seq
MIRT858686	hsa-miR-4799-3p	CLIP-seq
MIRT858687	hsa-miR-490-3p	CLIP-seq
MIRT858688	hsa-miR-600	CLIP-seq
MIRT858689	hsa-miR-615-5p	CLIP-seq
MIRT858690	hsa-miR-765	CLIP-seq
MIRT858691	hsa-miR-873	CLIP-seq
MIRT2192561	hsa-miR-140-5p	CLIP-seq
MIRT2192562	hsa-miR-3152-3p	CLIP-seq
MIRT2192563	hsa-miR-3545-5p	CLIP-seq
MIRT2192564	hsa-miR-3692	CLIP-seq
MIRT2192565	hsa-miR-4290	CLIP-seq
MIRT2192566	hsa-miR-4460	CLIP-seq
MIRT2192567	hsa-miR-4649-3p	CLIP-seq
MIRT2192568	hsa-miR-4694-5p	CLIP-seq
MIRT2192569	hsa-miR-4727-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001932	Process	Regulation of protein phosphorylation	IMP	25893857
GO:0001933	Process	Negative regulation of protein phosphorylation	IMP	25893857
GO:0005515	Function	Protein binding	IPI	33961781
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	IMP	23611113
GO:0016020	Component	Membrane	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0030948	Process	Negative regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0030948	Process	Negative regulation of vascular endothelial growth factor receptor signaling pathway	ISS
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0031252	Component	Cell leading edge	IDA	25893857
GO:0035020	Process	Regulation of Rac protein signal transduction	IBA
GO:0035020	Process	Regulation of Rac protein signal transduction	IEA
GO:0035020	Process	Regulation of Rac protein signal transduction	IMP	25893857
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IMP	25893857
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IEA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IBA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IEA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	25893857
GO:0044291	Component	Cell-cell contact zone	IBA
GO:0044291	Component	Cell-cell contact zone	IDA	25893857
GO:0050732	Process	Negative regulation of peptidyl-tyrosine phosphorylation	IMP	23611113
GO:0061041	Process	Regulation of wound healing	IBA
GO:0061041	Process	Regulation of wound healing	IEA
GO:0061041	Process	Regulation of wound healing	IMP	25893857
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IEA
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	ISS
GO:2000145	Process	Regulation of cell motility	IEA
GO:2000145	Process	Regulation of cell motility	IMP	25893857

Other IDs

• MIM: 609744
• HGNC: 30825
• e!Ensembl: ENSG00000105767

Protein

• UniProt ID: Q8NFZ8
• Protein name: Cell adhesion molecule 4 (Immunoglobulin superfamily member 4C) (IgSF4C) (Nectin-like protein 4) (NECL-4) (TSLC1-like protein 2)
• Protein function: Involved in the cell-cell adhesion. Has calcium- and magnesium-independent cell-cell adhesion activity. May have tumor-suppressor activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	26 → 123	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	123 → 210	CD80-like C2-set immunoglobulin domain	Domain
  PF13927	Ig_3	223 → 295		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, prostate, brain, kidney and some other organs. {ECO:0000269|PubMed:11536053, ECO:0000269|PubMed:16261159}.
• Sequence:

  MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPA
  RQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTV
  LVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSV
  ASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDT
  LVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHA
  RALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVRQKGSYLTHEA
  SGLDEQGEAREAFLNGSDGHKRKEEFFI

• Sequence length: 388

Related Genes

No strongly related genes found yet for CADM4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CADM4.