CABS1 (calcium binding protein, spermatid associated 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 85438
• Gene name: Calcium binding protein, spermatid associated 1
• Gene symbol: CABS1
• Synonyms (NCBI Gene): C4orf35, CLPH, NYD-SP26
• Chromosome: 4
• Chromosome location: 4q13.3

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT857372	hsa-miR-3609	CLIP-seq
MIRT857373	hsa-miR-3662	CLIP-seq
MIRT857374	hsa-miR-520g	CLIP-seq
MIRT857375	hsa-miR-520h	CLIP-seq
MIRT857376	hsa-miR-548ah	CLIP-seq
MIRT857377	hsa-miR-570	CLIP-seq
MIRT1954659	hsa-miR-3148	CLIP-seq
MIRT1954660	hsa-miR-3978	CLIP-seq
MIRT1954661	hsa-miR-4282	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016020	Component	Membrane	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IBA
GO:0031514	Component	Motile cilium	IEA
GO:0031514	Component	Motile cilium	ISS
GO:0042995	Component	Cell projection	IEA
GO:0097228	Component	Sperm principal piece	IEA
GO:0097228	Component	Sperm principal piece	ISS

Other IDs

• MIM: 618600
• HGNC: 30710
• e!Ensembl: ENSG00000145309

Protein

• UniProt ID: Q96KC9
• Protein name: Calcium-binding and spermatid-specific protein 1 (Testis development protein NYD-SP26)
• Protein function: Calcium-binding protein (By similarity). Essential for maintaining the structural integrity of the sperm flagella (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15367	CABS1	1 → 395	Calcium-binding and spermatid-specific protein 1	Family

• Sequence:

  MAEDGLPKIYSHPPTESSKTPTAATIFFGADNAIPKSETTITSEGDHVTSVNEYMLESDF
  STTTDNKLTAKKEKLKSEDDMGTDFIKSTTHLQKEITSLTGTTNSITRDSITEHFMPVKI
  GNISSPVTTVSLIDFSTDIAKEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFP
  RKKDEADMSNYNSSIKSNVPADEAVQVTDSTIPEAEIPPAPEESFTTIPDITALEEEKIT
  EIDLSVLEDDTSAVATLTDSDEKFITVFELTTSAEKDKDKREDTLLTDEETTEGASIWME
  RDTANEAETHSVLLTAVESRYDFVVPASIATNLVEESSTEEDLSETDNTETVPKITEPFS
  GTTSVLDTPDYKEDTSTTETDIFELLKEEPDEFMI

• Sequence length: 395

Related Genes

No strongly related genes found yet for CABS1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CABS1.