CA5BP1 (carbonic anhydrase 5B pseudogene 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 340591
Gene name Carbonic anhydrase 5B pseudogene 1
Gene symbol CA5BP1
Synonyms (NCBI Gene)
CA5BLCA5BPPRO2325
Chromosome X
Chromosome location Xp22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004089 Function Carbonate dehydratase activity IBA
GO:0005737 Component Cytoplasm IBA
GO:0005739 Component Mitochondrion IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 29544 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WTZ4
Protein name Putative inactive carbonic anhydrase 5B-like protein (CA-VB-like protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00194 Carb_anhydrase 24 → 105 Eukaryotic-type carbonic anhydrase Domain
Sequence 
MTQPPASTSGIMGTLSSWNLKILQINQLHLVHWNAVKFENFEDAALEENGLAVIGVFLKI
SETSGSPVSTGRPKPLARKLRPAQKHWVLQSRPFLSSQVQENCKVTYFHRKHWVRIRPLR
TTPPSWDYTRICIQREMVPARIRVLREMVPEAWRCFPNRLPLLSNIRPDFSKAPLAYVKR
WLWTARHPHSLSAAW
Sequence length 195
Interactions View interactions

No strongly related genes found yet for CA5BP1.

No additional diseases found yet through genes similar to CA5BP1.