CA11 (carbonic anhydrase 11)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 770
Gene name Carbonic anhydrase 11
Gene symbol CA11
Synonyms (NCBI Gene)
CA-RPCA-RP IICA-XICARP-2CARPX1
Chromosome 19
Chromosome location 19q13.33
Summary Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption,
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT028867 hsa-miR-26b-5p Microarray 19088304
MIRT2191855 hsa-miR-2909 CLIP-seq
MIRT2191856 hsa-miR-4278 CLIP-seq
MIRT2191857 hsa-miR-4764-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004089 Function Carbonate dehydratase activity TAS 9878252
GO:0005576 Component Extracellular region IEA
GO:0008270 Function Zinc ion binding IEA
GO:0016323 Component Basolateral plasma membrane IBA
GO:0016323 Component Basolateral plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604644 1370 ENSG00000063180
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75493
Protein name Carbonic anhydrase-related protein 11 (CA-RP XI) (CA-XI) (CARP XI) (Carbonic anhydrase-related protein 2) (CA-RP II) (CARP-2)
Protein function Does not have a catalytic activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00194 Carb_anhydrase 34 → 302 Eukaryotic-type carbonic anhydrase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed abundantly in the brain with moderate expression also present in spinal cord and thyroid.
Sequence 
MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNG
LAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGVPHGR
Sequence length 328
Interactions View interactions

No strongly related genes found yet for CA11.

No additional diseases found yet through genes similar to CA11.