C8orf88 (chromosome 8 open reading frame 88)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100127983 |
| Gene name | Chromosome 8 open reading frame 88 |
| Gene symbol | C8orf88 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 8 |
| Chromosome location | 8q21.3 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
|
|||||||||||||||||||||
|
|||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0DMB2 |
| Protein name | Uncharacterized protein C8orf88 |
| Family and domains | |
| Sequence |
METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQ |
| Sequence length | 117 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with C8orf88 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to C8orf88 (see Related Genes above), that are NOT already directly curated for C8orf88 itself -- a lead worth checking, not a confirmed association.
0
|
|