C5orf46 (chromosome 5 open reading frame 46)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 389336
Gene name Chromosome 5 open reading frame 46
Gene symbol C5orf46
Synonyms (NCBI Gene)
AP-64SSSP1
Chromosome 5
Chromosome location 5q32
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT849783 hsa-miR-198 CLIP-seq
MIRT849784 hsa-miR-219-5p CLIP-seq
MIRT849785 hsa-miR-432 CLIP-seq
MIRT849786 hsa-miR-4782-3p CLIP-seq
MIRT849787 hsa-miR-665 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
GO:0005576 Component Extracellular region IEA
GO:0070062 Component Extracellular exosome HDA 19199708
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UWT4
Protein name Uncharacterized protein C5orf46
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15144 DUF4576 1 → 87 Domain of unknown function (DUF4576) Family
Sequence 
MAVSVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENA
VEFILRSMSRSTGFMEFDDNEGKHSSK
Sequence length 87
Interactions View interactions

No strongly related genes found yet for C5orf46.

No additional diseases found yet through genes similar to C5orf46.