C3orf80 (chromosome 3 open reading frame 80)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401097
Gene name Chromosome 3 open reading frame 80
Gene symbol C3orf80
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3q25.33
miRNA miRNA information provided by mirtarbase database.
20 Show/Hide all (20)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT458369 hsa-miR-4433b-3p PAR-CLIP 23592263
MIRT458368 hsa-miR-5584-5p PAR-CLIP 23592263
MIRT458366 hsa-miR-6750-5p PAR-CLIP 23592263
MIRT458367 hsa-miR-6822-5p PAR-CLIP 23592263
MIRT458365 hsa-miR-9500 PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
F5H4A9
Protein name Uncharacterized membrane protein C3orf80
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15843 DUF4719 46 → 247 Domain of unknown function (DUF4719) Family
Sequence 
MWGPGVTAEGLSVAPAPPPLLPLLLLLALALVAPSRGGGGCAELACGERERCCDATNATA
VRCCKLPLHAFLDNVGWFVRKLSGLLILLVLFAIGYFLQRIICPSPRRYPRGQARPGQRP
GPPGGAGPLGGAGPPDDDDDSPALLRDEAAAGSQDSLLDSGGGGRGRGGGGRSDPSCASE
HEMRVVSPVFLQLPSYEEVKYLPTYEESMRLQQLSPGEVVLPVSVLGRPRGGVAAEPDGG
EGRYPLI
Sequence length 247
Interactions View interactions

No strongly related genes found yet for C3orf80.

No additional diseases found yet through genes similar to C3orf80.