C2CD5 (C2 calcium dependent domain containing 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9847
• Gene name: C2 calcium dependent domain containing 5
• Gene symbol: C2CD5
• Synonyms (NCBI Gene): CDP138, KIAA0528
• Chromosome: 12
• Chromosome location: 12p12.1

miRNA Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050212	hsa-miR-25-3p	CLASH	23622248
MIRT049892	hsa-miR-31-5p	CLASH	23622248
MIRT045109	hsa-miR-186-5p	CLASH	23622248
MIRT538806	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT538805	hsa-miR-6882-5p	PAR-CLIP	22012620
MIRT538804	hsa-miR-5683	PAR-CLIP	22012620
MIRT538803	hsa-miR-300	PAR-CLIP	22012620
MIRT538802	hsa-miR-381-3p	PAR-CLIP	22012620
MIRT538801	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT538800	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT538799	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT538798	hsa-miR-552-5p	PAR-CLIP	22012620
MIRT538806	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT538805	hsa-miR-6882-5p	PAR-CLIP	22012620
MIRT538804	hsa-miR-5683	PAR-CLIP	22012620
MIRT538803	hsa-miR-300	PAR-CLIP	22012620
MIRT538802	hsa-miR-381-3p	PAR-CLIP	22012620
MIRT538801	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT538800	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT538799	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT538798	hsa-miR-552-5p	PAR-CLIP	22012620

Gene ontology (GO) Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	21907143
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	21907143
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21907143
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IDA	21907143
GO:0005938	Component	Cell cortex	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IDA	21907143
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0010828	Process	Positive regulation of D-glucose transmembrane transport	IBA
GO:0010828	Process	Positive regulation of D-glucose transmembrane transport	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IDA	21907143
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031340	Process	Positive regulation of vesicle fusion	IBA
GO:0031340	Process	Positive regulation of vesicle fusion	IEA
GO:0031340	Process	Positive regulation of vesicle fusion	IMP	21907143
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032587	Component	Ruffle membrane	IDA	21907143
GO:0034451	Component	Centriolar satellite	IDA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0065002	Process	Intracellular protein transmembrane transport	IBA
GO:0065002	Process	Intracellular protein transmembrane transport	IMP	21907143
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0090314	Process	Positive regulation of protein targeting to membrane	IBA
GO:0090314	Process	Positive regulation of protein targeting to membrane	IMP	21907143

Other IDs

• MIM: 618044
• HGNC: 29062
• e!Ensembl: ENSG00000111731

Protein

• UniProt ID: Q86YS7
• Protein name: C2 domain-containing protein 5 (C2 domain-containing phosphoprotein of 138 kDa)
• Protein function: Required for insulin-stimulated glucose transport and glucose transporter SLC2A4/GLUT4 translocation from intracellular glucose storage vesicle (GSV) to the plasma membrane (PM) in adipocytes. Binds phospholipid membranes in a calcium-dependent
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	3 → 111	C2 domain	Domain

• Sequence:

  MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEV
  DDEDLQDEPLQITVLDHDTYSANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRG
  EINVVVKVDLFNDLNRFRQSSCGVKFFCTTSIPKCYRAVIIHGFVEELVVNEDPEYQWID
  RIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
  TACTLDKLSSPAAFLPACNSPSKEMKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSY
  SRQSSSSDTDLSLTPKTGMGSGSAGKEGGPFKALLRQQTQSALEQREFPFFTLTAFPPGF
  LVHVGGVVSARSVKLLDRIHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSI
  CEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFCHIPYDELNMPFPAHL
  TYCYNCRKQKVPDVLFTTIDLPTDATVIGKGCLIQARLCRLKKKAQAEANATAISNLLPF
  MEYEVHTQLMNKLKLKGMNALFGLRIQITVGENMLMGLASATGVYLAALPTPGGIQIAGK
  TPNDGSYEQHISHMQKKINDTIAKNKELYEINPPEISEEIIGSPIPEPRQRSRLLRSQSE
  SSDEVTELDLSHGKKDAFVLEIDDTDAMEDVHSLLTDVPPPSGFYSCNTEIMPGINNWTS
  EIQMFTSVRVIRLSSLNLTNQALNKNFNDLCENLLKSLYFKLRSMIPCCLCHVNFTVSLP
  EDELIQVTVTAVAITFDKNQALQTTKTPVEKSLQRASTDNEELLQFPLELCSDSLPSHPF
  PPAKAMTVEKASPVGDGNFRNRSAPPCANSTVGVVKMTPLSFIPGAKITKYLGIINMFFI
  RETTSLREEGGVSGFLHAFIAEVFAMVRAHVAALGGNAVVSYIMKQCVFMENPNKNQAQC
  LINVSGDAVVFVRESDLEVVSSQQPTTNCQSSCTEGEVTT

• Sequence length: 1000

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Gastric cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	25096995	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28880265		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28880265	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28880265	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28880265		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28880265		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29378832		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for C2CD5.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to C2CD5.