C22orf23 (chromosome 22 open reading frame 23)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84645
• Gene name: Chromosome 22 open reading frame 23
• Gene symbol: C22orf23
• Synonyms (NCBI Gene): EVG1, dJ1039K5.6
• Chromosome: 22
• Chromosome location: 22q13.1

miRNA Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT844817	hsa-miR-1200	CLIP-seq
MIRT844818	hsa-miR-3140-5p	CLIP-seq
MIRT844819	hsa-miR-3187-3p	CLIP-seq
MIRT844820	hsa-miR-3646	CLIP-seq
MIRT844821	hsa-miR-3681	CLIP-seq
MIRT844822	hsa-miR-4452	CLIP-seq
MIRT844823	hsa-miR-4529-5p	CLIP-seq
MIRT844824	hsa-miR-4652-3p	CLIP-seq
MIRT844825	hsa-miR-4680-3p	CLIP-seq
MIRT844826	hsa-miR-663b	CLIP-seq
MIRT1950341	hsa-miR-214	CLIP-seq
MIRT1950342	hsa-miR-3619-5p	CLIP-seq
MIRT1950343	hsa-miR-3918	CLIP-seq
MIRT1950344	hsa-miR-4512	CLIP-seq
MIRT1950345	hsa-miR-4530	CLIP-seq
MIRT1950346	hsa-miR-761	CLIP-seq
MIRT2188388	hsa-miR-605	CLIP-seq
MIRT2445490	hsa-miR-188-5p	CLIP-seq
MIRT2445491	hsa-miR-21	CLIP-seq
MIRT2445492	hsa-miR-2467-3p	CLIP-seq
MIRT2445493	hsa-miR-27a	CLIP-seq
MIRT2445494	hsa-miR-27b	CLIP-seq
MIRT2445495	hsa-miR-3065-3p	CLIP-seq
MIRT844819	hsa-miR-3187-3p	CLIP-seq
MIRT2445496	hsa-miR-3194-5p	CLIP-seq
MIRT2445497	hsa-miR-365	CLIP-seq
MIRT2445498	hsa-miR-3672	CLIP-seq
MIRT2445499	hsa-miR-3678-3p	CLIP-seq
MIRT2445500	hsa-miR-3907	CLIP-seq
MIRT2445501	hsa-miR-4257	CLIP-seq
MIRT2445502	hsa-miR-4258	CLIP-seq
MIRT2445503	hsa-miR-4291	CLIP-seq
MIRT2445504	hsa-miR-4307	CLIP-seq
MIRT2445505	hsa-miR-4312	CLIP-seq
MIRT2445506	hsa-miR-4435	CLIP-seq
MIRT2445507	hsa-miR-4461	CLIP-seq
MIRT2445508	hsa-miR-451	CLIP-seq
MIRT2445509	hsa-miR-4698	CLIP-seq
MIRT2445510	hsa-miR-4701-5p	CLIP-seq
MIRT2445511	hsa-miR-4766-5p	CLIP-seq
MIRT2445512	hsa-miR-4797-5p	CLIP-seq
MIRT2445513	hsa-miR-5096	CLIP-seq
MIRT2445514	hsa-miR-513a-5p	CLIP-seq
MIRT2445515	hsa-miR-522	CLIP-seq
MIRT2445516	hsa-miR-532-5p	CLIP-seq
MIRT2445517	hsa-miR-548s	CLIP-seq
MIRT2445518	hsa-miR-570	CLIP-seq
MIRT2445519	hsa-miR-588	CLIP-seq
MIRT2445520	hsa-miR-590-5p	CLIP-seq
MIRT2445521	hsa-miR-642a	CLIP-seq
MIRT2445522	hsa-miR-662	CLIP-seq
MIRT2445523	hsa-miR-759	CLIP-seq
MIRT844819	hsa-miR-3187-3p	CLIP-seq
MIRT2445504	hsa-miR-4307	CLIP-seq
MIRT2445506	hsa-miR-4435	CLIP-seq
MIRT2445510	hsa-miR-4701-5p	CLIP-seq
MIRT2445517	hsa-miR-548s	CLIP-seq
MIRT2445519	hsa-miR-588	CLIP-seq
MIRT2445522	hsa-miR-662	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488, 32296183, 33961781

Other IDs

• MIM: 619678
• HGNC: 18589
• e!Ensembl: ENSG00000128346

Protein

• UniProt ID: Q9BZE7
• Protein name: UPF0193 protein EVG1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05250	UPF0193	4 → 214	Uncharacterised protein family (UPF0193)	Family

• Sequence:

  MASQKQMEVVTKGTGFRRRPKTITYTPGTCELLRVMMKESKLTNIQQRHIMDIMKRGDAL
  PLQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLE
  KEKQRLQNIFATGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQ
  GKQYRGIILAEISQKLREMEDIDHRRSEELRKGLATT

• Sequence length: 217

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for C22orf23.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to C22orf23.