C1orf162 (chromosome 1 open reading frame 162)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 128346
Gene name Chromosome 1 open reading frame 162
Gene symbol C1orf162
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p13.2
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2187073 hsa-miR-3176 CLIP-seq
MIRT2187074 hsa-miR-3922-3p CLIP-seq
MIRT2187075 hsa-miR-4435 CLIP-seq
MIRT2187076 hsa-miR-4499 CLIP-seq
MIRT2187077 hsa-miR-548u CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NEQ5
Protein name Transmembrane protein C1orf162
Family and domains
Sequence 
MGGNGSTCKPDTERQGTLSTAAPTTSPAPCLSNHHNKKHLILAFCAGVLLTLLLIAFIFL
IIKSYRKYRRERLPISPGPLLRWVPLLSGTMADHSKPQAPDPHSDPPAKLSSIPGESLTY
ASTTFKLSEEKSNHLAENHSADFDPIVYAQIKVTN
Sequence length 155
Interactions View interactions

No strongly related genes found yet for C1orf162.

No additional diseases found yet through genes similar to C1orf162.