C1QTNF9B (C1q and TNF related 9B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387911
Gene name C1q and TNF related 9B
Gene symbol C1QTNF9B
Synonyms (NCBI Gene)
CTRP9B
Chromosome 13
Chromosome location 13q12.12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19666007, 28514442, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005581 Component Collagen trimer IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614148 34072 ENSG00000205863
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B2RNN3
Protein name Complement C1q and tumor necrosis factor-related protein 9B (C1q/TNF-related protein 9B) (CTRP9B) (Complement C1q and tumor necrosis factor-related protein 9-like)
Protein function Probable adipokine. Activates AMPK, AKT, and p44/42 MAPK signaling pathways.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00386 C1q 203 → 329 C1q domain Domain
PF01391 Collagen 23 → 82 Collagen triple helix repeat (20 copies) Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed at low levels. Not expressed in adipose tissues. {ECO:0000269|PubMed:19666007}.
Sequence 
MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGC
PGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGP
QGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGI
RGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAVGK
FTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTRDAYVSSEDQASGSIVLQLKLGDE
MWLQVTGGERFNGLFADEDDDTTFTGFLLFSSQ
Sequence length 333
Interactions View interactions

No strongly related genes found yet for C1QTNF9B.

No additional diseases found yet through genes similar to C1QTNF9B.