Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	388581
Gene name	C1q and TNF related 12
Gene symbol	C1QTNF12
Synonyms (NCBI Gene)	C1QDC2CTRP12FAM132A
Chromosome	1
Chromosome location	1p36.33

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0045721	Process	Negative regulation of gluconeogenesis	IBA
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0046323	Process	D-glucose import	IEA
GO:0046324	Process	Regulation of D-glucose import	IEA
GO:0046324	Process	Regulation of D-glucose import	ISS
GO:0046326	Process	Positive regulation of D-glucose import	IBA
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IBA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA

MIM	HGNC	e!Ensembl
616593	32308	ENSG00000184163

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q5T7M4
Protein name	Adipolin (Adipose-derived insulin-sensitizing factor) (C1q and TNF related protein 12) (Complement C1q tumor necrosis factor-related protein 12) [Cleaved into: Adipolin fC1QTNF12 (Adipolin fCTRP12) (Adipolin full-length form); Adipolin gC1QTNF12 (Adipolin
Protein function	Insulin-sensitizing adipocyte-secreted protein (adipokine) that regulates glucose metabolism in liver and adipose tissue. Promotes glucose uptake in adipocytes and suppresses de novo glucose production in hepatocytes via the PI3K-Akt signaling p
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Predominantly expressed by adipose tissues. {ECO:0000269\|PubMed:22275362}.
Sequence	MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASSREGLPEAPKP SQASGPEFSDAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHE FQELLKEATERRFSGLLDPLLPQGAGLRLVGEAFHCRLQGPRRVDKRTLVELHGFQAPAA QGAFLRGSGLSLASGRFTAPVSGIFQFSASLHVDHSELQGKARLRARDVVCVLICIESLC QRHTCLEAVSGLESNSRVFTLQVQGLLQLQAGQYASVFVDNGSGAVLTIQAGSSFSGLLL GT
Sequence length	302
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FATTY LIVER DISEASE	—	GWAS catalog	35611668	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	30595370, 41238958	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	28714469, 33536424	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Arteriosclerosis	Arteriosclerosis	BEFREE	30337217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30337217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29452073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30337217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30337217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30337217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22275362, 27657997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22275362, 27657997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27657997, 28207876	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22275362, 23068097, 24358263, 30540803	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28431867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30540803	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30874788	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with C1QTNF12 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for C1QTNF12.

Diseases Linked via Similar Genes Diseases curated for genes most similar to C1QTNF12 (see Related Genes above), that are NOT already directly curated for C1QTNF12 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to C1QTNF12.

C1QTNF12 (C1q and TNF related 12)

Bookmark This Gene