C1QL4 (complement C1q like 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 338761
Gene name Complement C1q like 4
Gene symbol C1QL4
Synonyms (NCBI Gene)
C1QTNF11CTRP11
Chromosome 12
Chromosome location 12q13.12
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2187640 hsa-miR-27a CLIP-seq
MIRT2187641 hsa-miR-27b CLIP-seq
MIRT2187642 hsa-miR-4476 CLIP-seq
MIRT2187643 hsa-miR-4480 CLIP-seq
MIRT2187644 hsa-miR-513a-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005581 Component Collagen trimer IEA
GO:0005615 Component Extracellular space IEA
GO:0042802 Function Identical protein binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615229 31416 ENSG00000186897
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86Z23
Protein name Complement C1q-like protein 4 (C1q and tumor necrosis factor-related protein 11) (C1q/TNF-related protein 11)
Protein function May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). May inhibit adipocyte differentiation at an early stage of the process (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00386 C1q 111 → 235 C1q domain Domain
Tissue specificity TISSUE SPECIFICITY: Highest expression levels in testis and adipose tissue, lower levels in skeletal muscle and kidney. {ECO:0000269|PubMed:23449976}.
Sequence 
MVLLLLVAIPLLVHSSRGPAHYEMLGRCRMVCDPHGPRGPGPDGAPASVPPFPPGAKGEV
GRRGKAGLRGPPGPPGPRGPPGEPGRPGPPGPPGPGPGGVAPAAGYVPRIAFYAGLRRPH
EGYEVLRFDDVVTNVGNAYEAASGKFTCPMPGVYFFAYHVLMRGGDGTSMWADLMKNGQV
RASAIAQDADQNYDYASNSVILHLDVGDEVFIKLDGGKVHGGNTNKYSTFSGFIIYPD
Sequence length 238
Interactions View interactions

No strongly related genes found yet for C1QL4.

No additional diseases found yet through genes similar to C1QL4.