C1QL3 (complement C1q like 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 389941
• Gene name: Complement C1q like 3
• Gene symbol: C1QL3
• Synonyms (NCBI Gene): C1QTNF13, C1ql, CTRP13, K100
• Chromosome: 10
• Chromosome location: 10p13

miRNA Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT842192	hsa-miR-103a	CLIP-seq
MIRT842193	hsa-miR-107	CLIP-seq
MIRT842194	hsa-miR-15a	CLIP-seq
MIRT842195	hsa-miR-15b	CLIP-seq
MIRT842196	hsa-miR-16	CLIP-seq
MIRT842197	hsa-miR-195	CLIP-seq
MIRT842198	hsa-miR-424	CLIP-seq
MIRT842199	hsa-miR-4275	CLIP-seq
MIRT842200	hsa-miR-4310	CLIP-seq
MIRT842201	hsa-miR-497	CLIP-seq
MIRT842194	hsa-miR-15a	CLIP-seq
MIRT842195	hsa-miR-15b	CLIP-seq
MIRT842196	hsa-miR-16	CLIP-seq
MIRT842197	hsa-miR-195	CLIP-seq
MIRT842198	hsa-miR-424	CLIP-seq
MIRT842201	hsa-miR-497	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005581	Component	Collagen trimer	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043083	Component	Synaptic cleft	IEA
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0097107	Process	Postsynaptic density assembly	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099645	Process	Neurotransmitter receptor localization to postsynaptic specialization membrane	IEA

Other IDs

• MIM: 615227
• HGNC: 19359
• e!Ensembl: ENSG00000165985

Protein

• UniProt ID: Q5VWW1
• Protein name: Complement C1q-like protein 3 (C1q and tumor necrosis factor-related protein 13) (C1q/TNF-related protein 13)
• Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00386	C1q	128 → 252	C1q domain	Domain
  PF01391	Collagen	59 → 116	Collagen triple helix repeat (20 copies)	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in adipose tissue, with expression levels at least 2 orders of magnitude higher than in other tissues, including brain and kidney. {ECO:0000269|PubMed:21378161}.
• Sequence:

  MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQ
  GPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAAT
  YSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMR
  GGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGN
  NNKYSTFSGFIIYAD

• Sequence length: 255

Related Genes

No strongly related genes found yet for C1QL3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to C1QL3.