Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	165257
Gene name	Complement C1q like 2
Gene symbol	C1QL2
Synonyms (NCBI Gene)	C1QTNF10CTRP10
Chromosome	2
Chromosome location	2q14.2

miRTarBase ID	miRNA	Experiments	Reference
MIRT842190	hsa-miR-4428	CLIP-seq
MIRT842191	hsa-miR-511	CLIP-seq

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence
GO:0005576	Component	Extracellular region	IEA
GO:0005581	Component	Collagen trimer	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043083	Component	Synaptic cleft	IEA
GO:0090128	Process	Regulation of synapse maturation	IEA
GO:0097107	Process	Postsynaptic density assembly	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099645	Process	Neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0150053	Component	Cerebellar climbing fiber to Purkinje cell synapse	IEA

MIM	HGNC	e!Ensembl
614330	24181	ENSG00000144119

Q7Z5L3

Protein name

Complement C1q-like protein 2 (C1q and tumor necrosis factor-related protein 10) (C1q/TNF-related protein 10)

Protein function

May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00386	C1q	160 → 284	C1q domain	Domain
PF01391	Collagen	72 → 135	Collagen triple helix repeat (20 copies)	Repeat

Sequence

MALGLLIAVPLLLQAAPRGAAHYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALE
VMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQ
LTAGTASGVGVVGGGAGVGGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYEVLKFDDV
VTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQ
NYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD

Sequence length

287

Interactions

View interactions

Related Genes Genes most often co-reported with C1QL2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for C1QL2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to C1QL2 (see Related Genes above), that are NOT already directly curated for C1QL2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to C1QL2.

C1QL2 (complement C1q like 2)

Save This Analysis