C19orf85 (chromosome 19 open reading frame 85)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 111064650 |
| Gene name | Chromosome 19 open reading frame 85 |
| Gene symbol | C19orf85 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 19 |
| Chromosome location | 19q13.42 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A1B0GUS0 |
| Protein name | Uncharacterized protein C19orf85 |
| Family and domains | |
| Sequence |
MHPGVPEGPGVSEPGPRELCAFVSGAAAHMLRALQPRRTRPPKRRPNHRRFLHNQICRQF |
| Sequence length | 222 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with C19orf85 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to C19orf85 (see Related Genes above), that are NOT already directly curated for C19orf85 itself -- a lead worth checking, not a confirmed association.
0
|
|