C19orf84 (chromosome 19 open reading frame 84)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 147646
Gene name Chromosome 19 open reading frame 84
Gene symbol C19orf84
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.41
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 38359823
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IEA
GO:0005654 Component Nucleoplasm ISS
GO:0010526 Process Transposable element silencing IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
I3L1E1
Protein name piRNA-mediated silencing protein C19orf84
Protein function Protein adapter involved in piRNA-directed transposon methylation by connecting PIWIL4-piRNA and DNA methylation machineries. The PIWIL4-piRNA pathway plays a central role during spermatogenesis by directing transposon DNA methylation and silenc
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17703 DUF5549 1 → 186 Family of unknown function (DUF5549) Family
Sequence 
MEQPKDGAGPEGNNLSLPSSGTEPWPPAPLPAPPPLLLNSTDPTHLGLPESVASVTVPIR
LDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWEVRHRPGWGRG
LHRRGLGRAEQPERGRAGGPGAGPRTPPMTLPSPPTLPAQDGKKEARGPEPPLETPLAAE
DWETEY
Sequence length 186
Interactions View interactions

No strongly related genes found yet for C19orf84.

No additional diseases found yet through genes similar to C19orf84.