C10orf62 (chromosome 10 open reading frame 62)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 414157
Gene name Chromosome 10 open reading frame 62
Gene symbol C10orf62
Synonyms (NCBI Gene)
bA548K23.1
Chromosome 10
Chromosome location 10q24.2
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1945465 hsa-miR-1266 CLIP-seq
MIRT1945466 hsa-miR-193a-5p CLIP-seq
MIRT1945467 hsa-miR-3127-5p CLIP-seq
MIRT1945468 hsa-miR-4518 CLIP-seq
MIRT1945469 hsa-miR-541 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19060904, 19447967, 25416956, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T681
Protein name Uncharacterized protein C10orf62
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17729 DUF5569 1 → 223 Family of unknown function (DUF5569) Family
Sequence 
MLWVQRKRRRKETSECPSDKDKSPESHKAKNESWIKSHFSRLSEEKLALDNNASASGNAT
QTESGSEEVSSTVHIETFTTRHGEVGSALHRESFTSRQKTSGPSVIQEIHQESGKAPSTD
EATWAAVAACTKEIDTQGRHLAHSMLQRAIAYQHSGHLESKDINQEELRALEEVEMKLQK
NFLTQRENTIAGANHTHTFYGHSHHSHHGHPSHQSHSLPNRRH
Sequence length 223
Interactions View interactions

No strongly related genes found yet for C10orf62.

No additional diseases found yet through genes similar to C10orf62.