C10orf126 (chromosome 10 open reading frame 126)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283080
Gene name Chromosome 10 open reading frame 126
Gene symbol C10orf126
Synonyms (NCBI Gene)
bA492M23.1
Chromosome 10
Chromosome location 10p12.1
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N4M7
Protein name Putative uncharacterized protein C10orf126
Family and domains
Sequence 
MNHCIQFSPQSLQRWLILPCYDLKLPIWANTTEFCPHGPRRASQDPQLLAWLPDQSLEVS
LELYDWNSMTFTLFLETVEPVAVESEGSGIFSFVWQQLIFPAEARWCFSWAQDCGLDGSF
PGSAHTEPFGKAAAGQGSVAGKEAKKAGPGFHRQLLYLQFQKRCLFNYPELL
Sequence length 172
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for C10orf126.

No additional diseases found yet through genes similar to C10orf126.