BTNL10P (butyrophilin like 10, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100129094
Gene name Butyrophilin like 10, pseudogene
Gene symbol BTNL10P
Synonyms (NCBI Gene)
BTN4BTNL10BUTR1
Chromosome 1
Chromosome location 1q42.13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001817 Process Regulation of cytokine production IBA
GO:0005102 Function Signaling receptor binding IBA
GO:0009897 Component External side of plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0050852 Process T cell receptor signaling pathway IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 42540 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MVZ5
Protein name Putative butyrophilin-like protein 10 pseudogene
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 37 → 146 Immunoglobulin V-set domain Domain
Sequence 
MAVTCDPEAFLSICFVTLVFLQLPLASIWKADFDVTGPHAPILAMAGGHVELQCQLFPNI
SAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTT
FDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVER
RDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLP
ATFSRSSQFTAWKAALPLILVAMGLVIAGGICIFWKRQREKNKASLEEERE
Sequence length 291
Interactions View interactions

No strongly related genes found yet for BTNL10P.

No additional diseases found yet through genes similar to BTNL10P.