BTC (betacellulin)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 685
• Gene name: Betacellulin
• Gene symbol: BTC
• Synonyms (NCBI Gene): -
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: This gene encodes a member of the epidermal growth factor (EGF) family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the secreted grow

miRNA Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022504	hsa-miR-124-3p	Microarray	18668037
MIRT023635	hsa-miR-1-3p	Microarray	18668037
MIRT024368	hsa-miR-215-5p	Microarray	19074876
MIRT026321	hsa-miR-192-5p	Microarray	19074876
MIRT437874	hsa-miR-200b-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437874	hsa-miR-200b-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437875	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT437875	hsa-miR-200c-3p	ELISA, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24762440
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT445035	hsa-miR-4717-3p	PAR-CLIP	22100165
MIRT445033	hsa-miR-5589-3p	PAR-CLIP	22100165
MIRT445034	hsa-miR-585-5p	PAR-CLIP	22100165
MIRT445032	hsa-miR-5682	PAR-CLIP	22100165
MIRT445031	hsa-miR-3161	PAR-CLIP	22100165
MIRT445030	hsa-miR-1273e	PAR-CLIP	22100165
MIRT445029	hsa-miR-599	PAR-CLIP	22100165
MIRT2183096	hsa-miR-4760-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	19740107, 25416956, 25910212, 26871637, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9168114, 12399441
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	8144591
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8439318
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	9168114, 12399441
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0038134	Process	ERBB2-EGFR signaling pathway	IEA
GO:0038138	Process	ERBB4-ERBB4 signaling pathway	IDA	9168114
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IBA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0048018	Function	Receptor ligand activity	IDA	9168114, 12399441
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	TAS	8144591
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA

Other IDs

• MIM: 600345
• HGNC: 1121
• e!Ensembl: ENSG00000174808

Protein

• UniProt ID: P35070
• Protein name: Probetacellulin [Cleaved into: Betacellulin (BTC)]
• Protein function: Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
• PDB: 1IOX , 1IP0 , 8U4J , 8U4K
• Tissue specificity: TISSUE SPECIFICITY: Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine. {ECO:0000269|PubMed:8919026}.
• Sequence:

  MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
  KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
  VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

• Sequence length: 178

Pathways

KEGG Pathway	Reactome Pathway
ErbB signaling pathway	Signaling by ERBB2
	Signaling by ERBB4
	SHC1 events in ERBB2 signaling
	PI3K events in ERBB4 signaling
	SHC1 events in ERBB4 signaling
	PIP3 activates AKT signaling
	Signaling by EGFR
	GRB2 events in EGFR signaling
	GAB1 signalosome
	SHC1 events in EGFR signaling
	EGFR downregulation
	GRB2 events in ERBB2 signaling
	PI3K events in ERBB2 signaling
	EGFR interacts with phospholipase C-gamma
	Constitutive Signaling by Aberrant PI3K in Cancer
	Inhibition of Signaling by Overexpressed EGFR
	RAF/MAP kinase cascade
	ERBB2 Regulates Cell Motility
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
	ERBB2 Activates PTK6 Signaling
	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis
	Downregulation of ERBB2 signaling
	Extra-nuclear estrogen signaling
	Estrogen-dependent nuclear events downstream of ESR-membrane signaling
	Signaling by ERBB2 KD Mutants
	Signaling by ERBB2 TMD/JMD mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (16)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	30573740	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPNEUMONIA	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	30804561, 33106845, 33909500, 37069358	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	37932435	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	25866641	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	30177863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHROPOIETIC PROTOPORPHYRIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	29903748, 37120605	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	GWAS catalog	29210060	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTOPORPHYRIA, ERYTHROPOIETIC	—	CTD	19267999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	25866641	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (57)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	31456099		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31145622		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	31096984		★☆☆☆☆ Found in Text Mining only
Brachydactyly type C	Brachydactyly	BEFREE	31835672		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	16676357		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18949710		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17962208	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18949710	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15274392	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	9648926		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	31835672		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29361822		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29361822	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12869389	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36232814	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16306376, 18388935		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16306376, 18388935		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16683131, 24875130		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	16683131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15793259, 15936459, 16306376, 16869959, 17479438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ductal Carcinoma	Ductal Carcinoma	LHGDN	17962208		★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	CTD_human_DG	19267999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ferrochelatase deficiency	Ferrochelatase Deficiency	CTD_human_DG	19267999		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	19298600	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19298600		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30183321		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	36415692	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28368610, 31678994		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28368610, 31678994		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19819964, 20836700		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	17989064		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	24440602, 29473434, 8456283		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16949929		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31528908		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	LHGDN	15274392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18949710		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29339358		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29100397		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28399526		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29339358, 31323001, 31654720		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17962208		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16949929, 23888072, 31528908		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	GWASCAT_DG	29903748		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	23144874	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16869959	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27129169	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29100397		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29100397		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20218926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20218926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25520391		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	36232814	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33466212	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28399526		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29207147	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

EREG 1 shared diseaseErythropoietic protoporphyria 28 shared pathwaysErbB signaling pathway, PIP3 activates AKT signaling, Estrogen-dependent nuclear events downstream of ESR-membrane signaling, RAF/MAP kinase cascade, Clathrin-mediated endocytosis, EGFR downregulation, Cargo recognition for clathrin-mediated endocytosis, Downregulation of ERBB2 signaling, Extra-nuclear estrogen signaling, Signaling by ERBB2, Signaling by ERBB4, SHC1 events in ERBB2 signaling +16 more 2 shared evidence sourcesDisgenet (Erythropoietic protoporphyria), CTD (Erythropoietic protoporphyria) Related via 28 shared pathways including ErbB signaling pathway, PIP3 activates AKT signaling — evidence mostly Disgenet. AREG 2 shared diseasesErythropoietic protoporphyria, Hemorrhoid 16 shared pathwaysErbB signaling pathway, PIP3 activates AKT signaling, Estrogen-dependent nuclear events downstream of ESR-membrane signaling, RAF/MAP kinase cascade, Clathrin-mediated endocytosis, EGFR downregulation, Cargo recognition for clathrin-mediated endocytosis, Extra-nuclear estrogen signaling, Constitutive Signaling by Aberrant PI3K in Cancer, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling, Signaling by EGFR, GAB1 signalosome +4 more 3 shared evidence sourcesDisgenet (Erythropoietic protoporphyria), GWAS catalog (Hemorrhoid), CTD (Erythropoietic protoporphyria) Related via 16 shared pathways including ErbB signaling pathway, PIP3 activates AKT signaling — evidence mostly Disgenet. FEZ2 2 shared diseasesDiverticular disease, Hemorrhoid 2 shared evidence sourcesGWAS catalog (Diverticular disease), GWAS catalog (Hemorrhoid) Related via 2 shared diseases including Diverticular disease, Hemorrhoid — evidence mostly GWAS catalog. KIAA1217 2 shared diseasesDiverticular disease, Hemorrhoid 2 shared evidence sourcesGWAS catalog (Diverticular disease), GWAS catalog (Hemorrhoid) Related via 2 shared diseases including Diverticular disease, Hemorrhoid — evidence mostly GWAS catalog. SLC9C2 2 shared diseasesNephrotic syndrome, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Nephrotic syndrome), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Nephrotic syndrome, Psychiatric disorders — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EREG	1	["Erythropoietic protoporphyria"]	28	["ErbB signaling pathway","PIP3 activates AKT signaling","Estrogen-dependent nuclear events downstream of ESR-membrane signaling","RAF\/MAP kinase cascade","Clathrin-mediated endocytosis","EGFR downregulation","Cargo recognition for clathrin-mediated endocytosis","Downregulation of ERBB2 signaling","Extra-nuclear estrogen signaling","Signaling by ERBB2","Signaling by ERBB4","SHC1 events in ERBB2 signaling"]	2	["Disgenet (Erythropoietic protoporphyria)","CTD (Erythropoietic protoporphyria)"]
AREG	2	["Erythropoietic protoporphyria","Hemorrhoid"]	16	["ErbB signaling pathway","PIP3 activates AKT signaling","Estrogen-dependent nuclear events downstream of ESR-membrane signaling","RAF\/MAP kinase cascade","Clathrin-mediated endocytosis","EGFR downregulation","Cargo recognition for clathrin-mediated endocytosis","Extra-nuclear estrogen signaling","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling","Signaling by EGFR","GAB1 signalosome"]	3	["Disgenet (Erythropoietic protoporphyria)","GWAS catalog (Hemorrhoid)","CTD (Erythropoietic protoporphyria)"]
FEZ2	2	["Diverticular disease","Hemorrhoid"]	0	[]	2	["GWAS catalog (Diverticular disease)","GWAS catalog (Hemorrhoid)"]
KIAA1217	2	["Diverticular disease","Hemorrhoid"]	0	[]	2	["GWAS catalog (Diverticular disease)","GWAS catalog (Hemorrhoid)"]
SLC9C2	2	["Nephrotic syndrome","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Nephrotic syndrome)","GWAS catalog (Psychiatric disorders)"]

Diseases Linked via Similar Genes

Ovarian neoplasms Linked via 2 of 5 related genesEREG, AREG Creutzfeldt-jakob disease Linked via 2 of 5 related genesEREG, AREG Myocardial ischemia Linked via 2 of 5 related genesAREG, FEZ2 Scoliosis Linked via 2 of 5 related genesKIAA1217, SLC9C2 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesEREG

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Ovarian neoplasms	2	["EREG","AREG"]
Creutzfeldt-jakob disease	2	["EREG","AREG"]
Myocardial ischemia	2	["AREG","FEZ2"]
Scoliosis	2	["KIAA1217","SLC9C2"]
Attention deficit hyperactivity disorder	1	["EREG"]