BRS3 (bombesin receptor subtype 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 680
• Gene name: Bombesin receptor subtype 3
• Gene symbol: BRS3
• Synonyms (NCBI Gene): BB3, BB3R, BBR3
• Chromosome: X
• Chromosome location: Xq26.3
• Summary: The protein encoded by this gene is a G protein-coupled membrane receptor that binds bombesin-like peptides. This binding results in activation of a phosphatidylinositol-calcium second messenger system, with physiological effects including regulation of m

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT645846	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT645845	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT645844	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT645843	hsa-miR-617	HITS-CLIP	23824327
MIRT645842	hsa-miR-6505-3p	HITS-CLIP	23824327
MIRT645841	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT645840	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT645846	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT645845	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT645844	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT645843	hsa-miR-617	HITS-CLIP	23824327
MIRT645842	hsa-miR-6505-3p	HITS-CLIP	23824327
MIRT645841	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT645840	hsa-miR-6868-3p	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
PPARG	Activation	17355223
TFAP2A	Activation	17355223

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004946	Function	Bombesin receptor activity	IEA
GO:0004946	Function	Bombesin receptor activity	TAS	8383682
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	9367152
GO:0006006	Process	Glucose metabolic process	TAS	9367152
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008217	Process	Regulation of blood pressure	TAS	9367152
GO:0008343	Process	Adult feeding behavior	TAS	9367152
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9367152
GO:0031989	Process	Bombesin receptor signaling pathway	IEA

Other IDs

• MIM: 300107
• HGNC: 1113
• e!Ensembl: ENSG00000102239

Protein

• UniProt ID: P32247
• Protein name: Bombesin receptor subtype-3 (BRS-3)
• Protein function: Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
• PDB: 8Y51 , 8Y52 , 8Y53
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	64 → 331	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: In germ cells in testis. Lung carcinoma cells.
• Sequence:

  MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV
  GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC
  KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL
  PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI
  ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
  YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT
  SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF

• Sequence length: 399

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Peptide ligand-binding receptors
	G alpha (q) signalling events

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PROKR1 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events. UTS2 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events. PROKR2 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events. NTSR2 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events. UTS2B 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PROKR1	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]
UTS2	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]
PROKR2	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]
NTSR2	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]
UTS2B	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]

Diseases Linked via Similar Genes

Stroke Linked via 2 of 5 related genesPROKR1, NTSR2 Hirschsprung disease Linked via 1 of 5 related genesPROKR1 Hyperalgesia Linked via 1 of 5 related genesPROKR1 Bradycardia Linked via 1 of 5 related genesUTS2 Breast cancer Linked via 1 of 5 related genesUTS2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Stroke	2	["PROKR1","NTSR2"]
Hirschsprung disease	1	["PROKR1"]
Hyperalgesia	1	["PROKR1"]
Bradycardia	1	["UTS2"]
Breast cancer	1	["UTS2"]