BPIFA4P (BPI fold containing family A member 4, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 317716
Gene name BPI fold containing family A member 4, pseudogene
Gene symbol BPIFA4P
Synonyms (NCBI Gene)
BASE
Chromosome 20
Chromosome location 20q11.21
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607627 20469 ENSG00000290942
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86YQ2
Protein name Putative BPIFA4P protein (BPI fold containing family A, member 4, pseudogene) (Breast cancer and salivary gland-expressed protein) (Putative latherin)
Protein function Major protein in sweat, has surfactant properties.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01273 LBP_BPI_CETP 18 → 177 LBP / BPI / CETP family, N-terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in breast cancer and salivary gland. {ECO:0000269|PubMed:12538848}.
Sequence 
MLNVSGLFVLLCGLLVSSSAQEVLAGVSSQLLNDLTQGLLRADFLPSLQTTGLQKPLSSA
FDGVSGLLDIFGPPLTNEINTVSIQVKNPQLLHVSIESTPQRKEATVQVPFTSELIVQLL
TMKPFTANMQSDIKVQIRLEKNVGGRYELAFGNCRLLPEAIWIQTGVQLAPAQNLLWQT
Sequence length 179
Interactions View interactions

No strongly related genes found yet for BPIFA4P.

No additional diseases found yet through genes similar to BPIFA4P.