BPIFA1 (BPI fold containing family A member 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51297
Gene name BPI fold containing family A member 1
Gene symbol BPIFA1
Synonyms (NCBI Gene)
LUNXNASGPLUNCSPLUNC1SPURTbA49G10.5
Chromosome 20
Chromosome location 20q11.21
Summary This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is tho
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017440 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26 Show/Hide all (26)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0002395 Process Immune response in nasopharyngeal-associated lymphoid tissue IBA
GO:0002395 Process Immune response in nasopharyngeal-associated lymphoid tissue IEP 21805676
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005576 Component Extracellular region IDA 11425234
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607412 15749 ENSG00000198183
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NP55
Protein name BPI fold-containing family A member 1 (Lung-specific protein X) (Nasopharyngeal carcinoma-related protein) (Palate lung and nasal epithelium clone protein) (Secretory protein in upper respiratory tracts) (Short PLUNC1) (SPLUNC1) (Tracheal epithelium-enric
Protein function Lipid-binding protein which shows high specificity for the surfactant phospholipid dipalmitoylphosphatidylcholine (DPPC) (PubMed:25223608). Plays a role in the innate immune responses of the upper airways (PubMed:23132494, PubMed:23499554). Redu
PDB 4KEG , 4KGH , 4KGO , 4N4X , 5I7J , 5I7K , 5I7L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01273 LBP_BPI_CETP 58 → 234 LBP / BPI / CETP family, N-terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium (at protein level) (PubMed:11018263, PubMed:11251963, PubMed:11425234, PubMed:12409287, PubMed:26559477). Specifically expressed
Sequence 
MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLL
SGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGL
VQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDC
THSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVH
DIVNMLIHGLQFVIKV
Sequence length 256
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Antimicrobial peptides

No strongly related genes found yet for BPIFA1.

No additional diseases found yet through genes similar to BPIFA1.