BPHL (biphenyl hydrolase like)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 670
• Gene name: Biphenyl hydrolase like
• Gene symbol: BPHL
• Synonyms (NCBI Gene): BPH-RP, MCNAA, VACVASE
• Chromosome: 6
• Chromosome location: 6p25.2
• Summary: This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants

miRNA Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT823741	hsa-miR-106a	CLIP-seq
MIRT823742	hsa-miR-106b	CLIP-seq
MIRT823743	hsa-miR-127-5p	CLIP-seq
MIRT823744	hsa-miR-129-5p	CLIP-seq
MIRT823745	hsa-miR-150	CLIP-seq
MIRT823746	hsa-miR-17	CLIP-seq
MIRT823747	hsa-miR-20a	CLIP-seq
MIRT823748	hsa-miR-20b	CLIP-seq
MIRT823749	hsa-miR-25	CLIP-seq
MIRT823750	hsa-miR-302a	CLIP-seq
MIRT823751	hsa-miR-302b	CLIP-seq
MIRT823752	hsa-miR-302c	CLIP-seq
MIRT823753	hsa-miR-302d	CLIP-seq
MIRT823754	hsa-miR-302e	CLIP-seq
MIRT823755	hsa-miR-3188	CLIP-seq
MIRT823756	hsa-miR-32	CLIP-seq
MIRT823757	hsa-miR-320e	CLIP-seq
MIRT823758	hsa-miR-3545-3p	CLIP-seq
MIRT823759	hsa-miR-3616-5p	CLIP-seq
MIRT823760	hsa-miR-363	CLIP-seq
MIRT823761	hsa-miR-3647-3p	CLIP-seq
MIRT823762	hsa-miR-3647-5p	CLIP-seq
MIRT823763	hsa-miR-3663-5p	CLIP-seq
MIRT823764	hsa-miR-367	CLIP-seq
MIRT823765	hsa-miR-3674	CLIP-seq
MIRT823766	hsa-miR-372	CLIP-seq
MIRT823767	hsa-miR-373	CLIP-seq
MIRT823768	hsa-miR-4282	CLIP-seq
MIRT823769	hsa-miR-4287	CLIP-seq
MIRT823770	hsa-miR-4293	CLIP-seq
MIRT823771	hsa-miR-4294	CLIP-seq
MIRT823772	hsa-miR-4469	CLIP-seq
MIRT823773	hsa-miR-4635	CLIP-seq
MIRT823774	hsa-miR-4663	CLIP-seq
MIRT823775	hsa-miR-4670-3p	CLIP-seq
MIRT823776	hsa-miR-4677-3p	CLIP-seq
MIRT823777	hsa-miR-4680-5p	CLIP-seq
MIRT823778	hsa-miR-4685-3p	CLIP-seq
MIRT823779	hsa-miR-4732-5p	CLIP-seq
MIRT823780	hsa-miR-512-3p	CLIP-seq
MIRT823781	hsa-miR-519d	CLIP-seq
MIRT823782	hsa-miR-520a-3p	CLIP-seq
MIRT823783	hsa-miR-520b	CLIP-seq
MIRT823784	hsa-miR-520c-3p	CLIP-seq
MIRT823785	hsa-miR-520d-3p	CLIP-seq
MIRT823786	hsa-miR-520e	CLIP-seq
MIRT823787	hsa-miR-520g	CLIP-seq
MIRT823788	hsa-miR-520h	CLIP-seq
MIRT823789	hsa-miR-548ae	CLIP-seq
MIRT823790	hsa-miR-548aj	CLIP-seq
MIRT823791	hsa-miR-548am	CLIP-seq
MIRT823792	hsa-miR-548x	CLIP-seq
MIRT823793	hsa-miR-573	CLIP-seq
MIRT823794	hsa-miR-877	CLIP-seq
MIRT823795	hsa-miR-92a	CLIP-seq
MIRT823796	hsa-miR-92b	CLIP-seq
MIRT823797	hsa-miR-93	CLIP-seq
MIRT1943555	hsa-miR-122	CLIP-seq
MIRT1943556	hsa-miR-3198	CLIP-seq
MIRT1943557	hsa-miR-4275	CLIP-seq
MIRT1943558	hsa-miR-4309	CLIP-seq
MIRT1943559	hsa-miR-4423-5p	CLIP-seq
MIRT1943560	hsa-miR-4726-3p	CLIP-seq
MIRT2182210	hsa-miR-1184	CLIP-seq
MIRT1943555	hsa-miR-122	CLIP-seq
MIRT823743	hsa-miR-127-5p	CLIP-seq
MIRT2182211	hsa-miR-1301	CLIP-seq
MIRT2182212	hsa-miR-219-2-3p	CLIP-seq
MIRT2182213	hsa-miR-2964a-3p	CLIP-seq
MIRT1943556	hsa-miR-3198	CLIP-seq
MIRT2182214	hsa-miR-3910	CLIP-seq
MIRT1943557	hsa-miR-4275	CLIP-seq
MIRT823770	hsa-miR-4293	CLIP-seq
MIRT1943558	hsa-miR-4309	CLIP-seq
MIRT2182215	hsa-miR-4418	CLIP-seq
MIRT1943559	hsa-miR-4423-5p	CLIP-seq
MIRT2182216	hsa-miR-4452	CLIP-seq
MIRT2182217	hsa-miR-4514	CLIP-seq
MIRT2182218	hsa-miR-4660	CLIP-seq
MIRT823776	hsa-miR-4677-3p	CLIP-seq
MIRT2182219	hsa-miR-4692	CLIP-seq
MIRT1943560	hsa-miR-4726-3p	CLIP-seq
MIRT2182220	hsa-miR-5047	CLIP-seq
MIRT2182221	hsa-miR-509-3-5p	CLIP-seq
MIRT2182222	hsa-miR-509-5p	CLIP-seq
MIRT2182223	hsa-miR-548an	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0006520	Process	Amino acid metabolic process	TAS	7759552
GO:0006805	Process	Xenobiotic metabolic process	IDA	32196348
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0009636	Process	Response to toxic substance	TAS	7759552
GO:0016787	Function	Hydrolase activity	IEA
GO:0017171	Function	Serine hydrolase activity	IBA
GO:0017171	Function	Serine hydrolase activity	IDA	18256025
GO:0046872	Function	Metal ion binding	IEA
GO:0047658	Function	Alpha-amino-acid esterase activity	IDA	18256025, 32196348
GO:0047658	Function	Alpha-amino-acid esterase activity	TAS
GO:0050667	Process	Homocysteine metabolic process	IDA	25333274

Other IDs

• MIM: 603156
• HGNC: 1094
• e!Ensembl: ENSG00000137274

Protein

• UniProt ID: Q86WA6
• Protein name: Serine hydrolase BPHL (EC 3.1.-.-) (Biphenyl hydrolase-like protein) (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA) (L-homocysteine-thiolactonase BPHL) (Valacyclovir hydrolase) (VACVase) (Valacyclovirase
• Protein function: Specific alpha-amino acid ester serine hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol (PubMed:12732646, PubMed:15832508,
• PDB: 2OCG , 2OCI , 2OCK , 2OCL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00561	Abhydrolase_1	61 → 195	alpha/beta hydrolase fold	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle. {ECO:0000269|PubMed:7759552}.
• Sequence:

  MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGD
  HAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKD
  AVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIR
  DVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVH
  GEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

• Sequence length: 291

Pathways

Reactome Pathway

POLB-Dependent Long Patch Base Excision Repair

Phase I - Functionalization of compounds

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CORTICAL DYSPLASIA, COMPLEX, WITH OTHER BRAIN MALFORMATIONS 5	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (17)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	22839996, 30121252		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12732646	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24211580, 31130856, 31142510		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30889383		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22918473, 30864743		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26624983		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22839996		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24211580, 31130856, 31142510		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30889383		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31273064		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31176615, 31827085		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23736962		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30864743		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22940495		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30889383		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31273064		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29336669	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for BPHL.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BPHL.