BMX (BMX non-receptor tyrosine kinase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 660
• Gene name: BMX non-receptor tyrosine kinase
• Gene symbol: BMX
• Synonyms (NCBI Gene): ETK, PSCTK2, PSCTK3
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyro

miRNA Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735520	hsa-miR-218-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, In situ hybridization	31477834
MIRT1943410	hsa-miR-1298	CLIP-seq
MIRT1943411	hsa-miR-361-5p	CLIP-seq
MIRT1943412	hsa-miR-4775	CLIP-seq
MIRT1943413	hsa-miR-590-3p	CLIP-seq
MIRT1943414	hsa-miR-664	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002250	Process	Adaptive immune response	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	7970727
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	10688651, 11331870
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10688651, 11331870, 16186805, 22939624, 25416956, 25814554, 31515488, 31980649, 32296183, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0006468	Process	Protein phosphorylation	TAS	7970727
GO:0006661	Process	Phosphatidylinositol biosynthetic process	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IDA	10688651, 11331870
GO:0007498	Process	Mesoderm development	TAS	9520419
GO:0008270	Function	Zinc ion binding	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032587	Component	Ruffle membrane	IDA	11331870
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	11331870
GO:0046872	Function	Metal ion binding	IEA
GO:0050853	Process	B cell receptor signaling pathway	IBA

Other IDs

• MIM: 300101
• HGNC: 1079
• e!Ensembl: ENSG00000102010

Protein

• UniProt ID: P51813
• Protein name: Cytoplasmic tyrosine-protein kinase BMX (EC 2.7.10.2) (Bone marrow tyrosine kinase gene in chromosome X protein) (Epithelial and endothelial tyrosine kinase) (ETK) (NTK38)
• Protein function: Non-receptor tyrosine kinase that plays central but diverse modulatory roles in various signaling processes involved in the regulation of actin reorganization, cell migration, cell proliferation and survival, cell adhesion, and apoptosis. Partic
• PDB: 2EKX , 2YS2 , 3SXR , 3SXS , 6I99 , 8X2A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	296 → 377	SH2 domain	Domain
  PF00169	PH	5 → 111	PH domain	Domain
  PF00779	BTK	119 → 148	BTK motif	Motif
  PF07714	PK_Tyr_Ser-Thr	417 → 666	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in cells with great migratory potential, including endothelial cells and metastatic carcinoma cell lines.
• Sequence:

  MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
  RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKY
  HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVL
  KMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF
  PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGN
  ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
  LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
  KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS
  KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
  NCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
  LMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQ
  QLLSSIEPLREKDKH

• Sequence length: 675

Pathways

Reactome Pathway

Apoptotic cleavage of cellular proteins

Synthesis of PIPs at the plasma membrane

Related Genes

No strongly related genes found yet for BMX.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BMX.