BLID (BH3-like motif containing, cell death inducer)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 414899 |
| Gene name | BH3-like motif containing, cell death inducer |
| Gene symbol | BLID |
| Synonyms (NCBI Gene) |
BRCC2
|
| Chromosome | 11 |
| Chromosome location | 11q24.1 |
| Summary | This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion. [provided by RefSeq, Aug 2011] |
|
miRNA
miRNA information provided by mirtarbase database.
2
|
|||||||||||||
|
|||||||||||||
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
|
|||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8IZY5 |
| Protein name | BH3-like motif-containing cell death inducer (Breast cancer cell protein 2) |
| Protein function | Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death. |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:15069058}. |
| Sequence |
MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLP |
| Sequence length | 108 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with BLID across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to BLID (see Related Genes above), that are NOT already directly curated for BLID itself -- a lead worth checking, not a confirmed association.
0
|
|